SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76787143|ref|YP_328949.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76787143|ref|YP_328949.1|
Domain Number 1 Region: 44-91
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000439
Family Terminase gpNU1 subunit domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76787143|ref|YP_328949.1|
Sequence length 93
Comment hypothetical protein SAK_0281 [Streptococcus agalactiae A909]
Sequence
MTEGFTIQLPKVTEKKLLARYDDMLQKAIEKALEDKELYKPIVRMAGLCRWLDVSTTTVV
KWQKQGGMPHMVIDGVTLYDKHKVAQWLQQFER
Download sequence
Identical sequences A0A072EJN6 A0A076YSH2 Q8E7E0 S8NPF3 S8P253 S8PYM5 S9LYJ4
WP_000134666.1.100254 WP_000134666.1.100766 WP_000134666.1.101195 WP_000134666.1.101222 WP_000134666.1.101267 WP_000134666.1.101938 WP_000134666.1.101956 WP_000134666.1.102056 WP_000134666.1.10371 WP_000134666.1.10618 WP_000134666.1.11465 WP_000134666.1.1163 WP_000134666.1.11756 WP_000134666.1.12102 WP_000134666.1.12166 WP_000134666.1.12331 WP_000134666.1.12688 WP_000134666.1.12755 WP_000134666.1.12978 WP_000134666.1.13064 WP_000134666.1.13285 WP_000134666.1.13384 WP_000134666.1.13553 WP_000134666.1.13737 WP_000134666.1.1437 WP_000134666.1.14953 WP_000134666.1.14960 WP_000134666.1.15526 WP_000134666.1.16134 WP_000134666.1.16595 WP_000134666.1.16737 WP_000134666.1.1681 WP_000134666.1.17056 WP_000134666.1.17489 WP_000134666.1.1760 WP_000134666.1.17709 WP_000134666.1.18047 WP_000134666.1.18450 WP_000134666.1.18829 WP_000134666.1.18841 WP_000134666.1.18933 WP_000134666.1.19604 WP_000134666.1.20188 WP_000134666.1.20511 WP_000134666.1.21522 WP_000134666.1.21525 WP_000134666.1.21779 WP_000134666.1.22004 WP_000134666.1.222 WP_000134666.1.22247 WP_000134666.1.22801 WP_000134666.1.23380 WP_000134666.1.24441 WP_000134666.1.24475 WP_000134666.1.24845 WP_000134666.1.25647 WP_000134666.1.25998 WP_000134666.1.26029 WP_000134666.1.26046 WP_000134666.1.26056 WP_000134666.1.26300 WP_000134666.1.26357 WP_000134666.1.26386 WP_000134666.1.26791 WP_000134666.1.27880 WP_000134666.1.28738 WP_000134666.1.29020 WP_000134666.1.29163 WP_000134666.1.29238 WP_000134666.1.29352 WP_000134666.1.30603 WP_000134666.1.30703 WP_000134666.1.30710 WP_000134666.1.3074 WP_000134666.1.31109 WP_000134666.1.3112 WP_000134666.1.32728 WP_000134666.1.32745 WP_000134666.1.34276 WP_000134666.1.34467 WP_000134666.1.34475 WP_000134666.1.34896 WP_000134666.1.34906 WP_000134666.1.35443 WP_000134666.1.36095 WP_000134666.1.36202 WP_000134666.1.36258 WP_000134666.1.36878 WP_000134666.1.3691 WP_000134666.1.36977 WP_000134666.1.37523 WP_000134666.1.37570 WP_000134666.1.3814 WP_000134666.1.3880 WP_000134666.1.38842 WP_000134666.1.3930 WP_000134666.1.3937 WP_000134666.1.3963 WP_000134666.1.40015 WP_000134666.1.40359 WP_000134666.1.41269 WP_000134666.1.41399 WP_000134666.1.41646 WP_000134666.1.41663 WP_000134666.1.41785 WP_000134666.1.4215 WP_000134666.1.42225 WP_000134666.1.44374 WP_000134666.1.44727 WP_000134666.1.44746 WP_000134666.1.44957 WP_000134666.1.45 WP_000134666.1.45103 WP_000134666.1.45150 WP_000134666.1.45180 WP_000134666.1.45790 WP_000134666.1.45976 WP_000134666.1.47485 WP_000134666.1.47608 WP_000134666.1.48239 WP_000134666.1.48557 WP_000134666.1.49421 WP_000134666.1.49508 WP_000134666.1.49888 WP_000134666.1.5055 WP_000134666.1.50552 WP_000134666.1.50776 WP_000134666.1.51102 WP_000134666.1.51114 WP_000134666.1.51570 WP_000134666.1.51780 WP_000134666.1.52470 WP_000134666.1.52729 WP_000134666.1.52916 WP_000134666.1.53087 WP_000134666.1.54487 WP_000134666.1.54629 WP_000134666.1.54752 WP_000134666.1.54818 WP_000134666.1.54896 WP_000134666.1.55753 WP_000134666.1.564 WP_000134666.1.56404 WP_000134666.1.56602 WP_000134666.1.56930 WP_000134666.1.57262 WP_000134666.1.57407 WP_000134666.1.57721 WP_000134666.1.57900 WP_000134666.1.58254 WP_000134666.1.58988 WP_000134666.1.59040 WP_000134666.1.59057 WP_000134666.1.59565 WP_000134666.1.5977 WP_000134666.1.60093 WP_000134666.1.60702 WP_000134666.1.61267 WP_000134666.1.61676 WP_000134666.1.61790 WP_000134666.1.62267 WP_000134666.1.62362 WP_000134666.1.63367 WP_000134666.1.63508 WP_000134666.1.6360 WP_000134666.1.63764 WP_000134666.1.64182 WP_000134666.1.64459 WP_000134666.1.64468 WP_000134666.1.64651 WP_000134666.1.64713 WP_000134666.1.64967 WP_000134666.1.65036 WP_000134666.1.65195 WP_000134666.1.65323 WP_000134666.1.6564 WP_000134666.1.66063 WP_000134666.1.67008 WP_000134666.1.67759 WP_000134666.1.67859 WP_000134666.1.68443 WP_000134666.1.68641 WP_000134666.1.68788 WP_000134666.1.68827 WP_000134666.1.69023 WP_000134666.1.69101 WP_000134666.1.69163 WP_000134666.1.70286 WP_000134666.1.70391 WP_000134666.1.70397 WP_000134666.1.70742 WP_000134666.1.70879 WP_000134666.1.70897 WP_000134666.1.70932 WP_000134666.1.71554 WP_000134666.1.71606 WP_000134666.1.71709 WP_000134666.1.72464 WP_000134666.1.72821 WP_000134666.1.73137 WP_000134666.1.73449 WP_000134666.1.73585 WP_000134666.1.73637 WP_000134666.1.73692 WP_000134666.1.73856 WP_000134666.1.74086 WP_000134666.1.74717 WP_000134666.1.74933 WP_000134666.1.75020 WP_000134666.1.75293 WP_000134666.1.7586 WP_000134666.1.75882 WP_000134666.1.76610 WP_000134666.1.77005 WP_000134666.1.77757 WP_000134666.1.78251 WP_000134666.1.7882 WP_000134666.1.79135 WP_000134666.1.79474 WP_000134666.1.79724 WP_000134666.1.80180 WP_000134666.1.80460 WP_000134666.1.81080 WP_000134666.1.81115 WP_000134666.1.81168 WP_000134666.1.81280 WP_000134666.1.81506 WP_000134666.1.82198 WP_000134666.1.82293 WP_000134666.1.82501 WP_000134666.1.83071 WP_000134666.1.83198 WP_000134666.1.8340 WP_000134666.1.83465 WP_000134666.1.83616 WP_000134666.1.84093 WP_000134666.1.84119 WP_000134666.1.84909 WP_000134666.1.852 WP_000134666.1.85966 WP_000134666.1.8625 WP_000134666.1.86651 WP_000134666.1.86986 WP_000134666.1.87033 WP_000134666.1.87412 WP_000134666.1.87697 WP_000134666.1.87807 WP_000134666.1.87882 WP_000134666.1.88248 WP_000134666.1.88296 WP_000134666.1.88357 WP_000134666.1.887 WP_000134666.1.89132 WP_000134666.1.89248 WP_000134666.1.89303 WP_000134666.1.89336 WP_000134666.1.90068 WP_000134666.1.90074 WP_000134666.1.90411 WP_000134666.1.90530 WP_000134666.1.90666 WP_000134666.1.90941 WP_000134666.1.91002 WP_000134666.1.9136 WP_000134666.1.92184 WP_000134666.1.9295 WP_000134666.1.93080 WP_000134666.1.933 WP_000134666.1.93323 WP_000134666.1.93793 WP_000134666.1.93825 WP_000134666.1.9386 WP_000134666.1.94370 WP_000134666.1.94973 WP_000134666.1.95577 WP_000134666.1.95950 WP_000134666.1.96087 WP_000134666.1.96868 WP_000134666.1.96943 WP_000134666.1.9711 WP_000134666.1.97166 WP_000134666.1.97836 WP_000134666.1.97838 WP_000134666.1.97850 WP_000134666.1.98346 WP_000134666.1.98370 WP_000134666.1.99019 WP_000134666.1.99241 WP_000134666.1.99286 205921.SAK_0281 211110.gbs0214 gi|406708747|ref|YP_006763473.1| gi|76787143|ref|YP_328949.1| gi|25010289|ref|NP_734684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]