SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76787252|ref|YP_329575.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76787252|ref|YP_329575.1|
Domain Number 1 Region: 67-247
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.34e-40
Family Biotin holoenzyme synthetase 0.002
Further Details:      
 
Domain Number 2 Region: 3-59
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000017
Family Biotin repressor-like 0.021
Further Details:      
 
Domain Number 3 Region: 265-308
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.000000206
Family Biotin repressor (BirA) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76787252|ref|YP_329575.1|
Sequence length 311
Comment biotin--protein ligase [Streptococcus agalactiae A909]
Sequence
MKTYEKIYQILSKNNNFISGETMANQLNISRTAIWKGIKTLEELGLEIESVTNKGYRLVS
GDILLPEQLEQEIGIKVSLNNNSASTQLDAKMGIESKLKTPHLFLAPNQKKAKGRFDRPF
FTSNQGGIYMSLLLQPNVPIEDIKPYTVMVASSAVKAISRLTGITPEIKWVNDIYLDNKK
IAGILTEAIASVESGLVTNVIIGLGINFYIKEFPRALTKRAGSLFTEQPTITRNQLITEI
WNLFFNIPLEDHLKVYREKSLVLDRTVSFMDGQTMYSGKAIDITDKGYLVVELDDGQLKT
LRSGEISLSSW
Download sequence
Identical sequences A0A076Z3F2 A0A1F0CFM0 E7S4T9 Q8E0A4 S8FMY6 S8H8P6 S8HT16 S8NZH2 S8PAB9 S8Q5Z4 S9ARH9 S9BJ28 S9BJU9 S9L3T1
gi|76787252|ref|YP_329575.1| NP_687845.1.71890 WP_001872319.1.100037 WP_001872319.1.100058 WP_001872319.1.100254 WP_001872319.1.10029 WP_001872319.1.100355 WP_001872319.1.100367 WP_001872319.1.100766 WP_001872319.1.100991 WP_001872319.1.101222 WP_001872319.1.101267 WP_001872319.1.101296 WP_001872319.1.101328 WP_001872319.1.101830 WP_001872319.1.101853 WP_001872319.1.101864 WP_001872319.1.101938 WP_001872319.1.101956 WP_001872319.1.10297 WP_001872319.1.10371 WP_001872319.1.10618 WP_001872319.1.1067 WP_001872319.1.10723 WP_001872319.1.10924 WP_001872319.1.11248 WP_001872319.1.11446 WP_001872319.1.11465 WP_001872319.1.11756 WP_001872319.1.12072 WP_001872319.1.12166 WP_001872319.1.12215 WP_001872319.1.12331 WP_001872319.1.12363 WP_001872319.1.1251 WP_001872319.1.12619 WP_001872319.1.12688 WP_001872319.1.12755 WP_001872319.1.12978 WP_001872319.1.13008 WP_001872319.1.13064 WP_001872319.1.13285 WP_001872319.1.13384 WP_001872319.1.13553 WP_001872319.1.1402 WP_001872319.1.14040 WP_001872319.1.14140 WP_001872319.1.14275 WP_001872319.1.14324 WP_001872319.1.1437 WP_001872319.1.14563 WP_001872319.1.14738 WP_001872319.1.14953 WP_001872319.1.14960 WP_001872319.1.15385 WP_001872319.1.15417 WP_001872319.1.15526 WP_001872319.1.15556 WP_001872319.1.16134 WP_001872319.1.16165 WP_001872319.1.16342 WP_001872319.1.16535 WP_001872319.1.16580 WP_001872319.1.16595 WP_001872319.1.16706 WP_001872319.1.17074 WP_001872319.1.17339 WP_001872319.1.17380 WP_001872319.1.17489 WP_001872319.1.17506 WP_001872319.1.1760 WP_001872319.1.17709 WP_001872319.1.1775 WP_001872319.1.18047 WP_001872319.1.18263 WP_001872319.1.18425 WP_001872319.1.18450 WP_001872319.1.18747 WP_001872319.1.18829 WP_001872319.1.18841 WP_001872319.1.18933 WP_001872319.1.19604 WP_001872319.1.19892 WP_001872319.1.19950 WP_001872319.1.20123 WP_001872319.1.20188 WP_001872319.1.20258 WP_001872319.1.20326 WP_001872319.1.20511 WP_001872319.1.20791 WP_001872319.1.20847 WP_001872319.1.21061 WP_001872319.1.21522 WP_001872319.1.21779 WP_001872319.1.21860 WP_001872319.1.2195 WP_001872319.1.22004 WP_001872319.1.22139 WP_001872319.1.222 WP_001872319.1.22552 WP_001872319.1.23380 WP_001872319.1.23384 WP_001872319.1.23508 WP_001872319.1.24475 WP_001872319.1.24845 WP_001872319.1.25781 WP_001872319.1.25998 WP_001872319.1.26056 WP_001872319.1.26258 WP_001872319.1.26300 WP_001872319.1.26312 WP_001872319.1.26357 WP_001872319.1.26386 WP_001872319.1.2651 WP_001872319.1.26827 WP_001872319.1.27024 WP_001872319.1.2754 WP_001872319.1.27583 WP_001872319.1.27880 WP_001872319.1.27958 WP_001872319.1.28021 WP_001872319.1.28342 WP_001872319.1.28624 WP_001872319.1.28738 WP_001872319.1.29020 WP_001872319.1.29163 WP_001872319.1.29352 WP_001872319.1.29410 WP_001872319.1.29470 WP_001872319.1.29719 WP_001872319.1.29888 WP_001872319.1.30062 WP_001872319.1.30252 WP_001872319.1.30603 WP_001872319.1.30703 WP_001872319.1.30710 WP_001872319.1.3074 WP_001872319.1.31109 WP_001872319.1.3112 WP_001872319.1.3166 WP_001872319.1.31888 WP_001872319.1.31896 WP_001872319.1.32520 WP_001872319.1.32603 WP_001872319.1.32728 WP_001872319.1.32745 WP_001872319.1.32818 WP_001872319.1.33723 WP_001872319.1.34227 WP_001872319.1.34276 WP_001872319.1.34467 WP_001872319.1.34475 WP_001872319.1.34896 WP_001872319.1.34906 WP_001872319.1.34981 WP_001872319.1.35119 WP_001872319.1.35216 WP_001872319.1.35428 WP_001872319.1.35443 WP_001872319.1.35908 WP_001872319.1.35937 WP_001872319.1.36095 WP_001872319.1.36202 WP_001872319.1.36258 WP_001872319.1.36878 WP_001872319.1.36977 WP_001872319.1.37018 WP_001872319.1.37098 WP_001872319.1.37523 WP_001872319.1.37570 WP_001872319.1.3814 WP_001872319.1.38237 WP_001872319.1.38578 WP_001872319.1.3880 WP_001872319.1.38842 WP_001872319.1.38910 WP_001872319.1.3930 WP_001872319.1.3937 WP_001872319.1.39381 WP_001872319.1.39386 WP_001872319.1.3963 WP_001872319.1.40015 WP_001872319.1.40055 WP_001872319.1.40203 WP_001872319.1.40812 WP_001872319.1.41269 WP_001872319.1.41399 WP_001872319.1.41646 WP_001872319.1.41663 WP_001872319.1.41785 WP_001872319.1.42144 WP_001872319.1.4215 WP_001872319.1.42225 WP_001872319.1.42271 WP_001872319.1.42477 WP_001872319.1.42844 WP_001872319.1.43199 WP_001872319.1.43571 WP_001872319.1.43981 WP_001872319.1.44371 WP_001872319.1.44374 WP_001872319.1.4446 WP_001872319.1.44614 WP_001872319.1.44712 WP_001872319.1.44727 WP_001872319.1.44746 WP_001872319.1.45 WP_001872319.1.45103 WP_001872319.1.45150 WP_001872319.1.45180 WP_001872319.1.45540 WP_001872319.1.45551 WP_001872319.1.45733 WP_001872319.1.45790 WP_001872319.1.45896 WP_001872319.1.45976 WP_001872319.1.46116 WP_001872319.1.46790 WP_001872319.1.46992 WP_001872319.1.47485 WP_001872319.1.47608 WP_001872319.1.47678 WP_001872319.1.48052 WP_001872319.1.48239 WP_001872319.1.48916 WP_001872319.1.49082 WP_001872319.1.49421 WP_001872319.1.49423 WP_001872319.1.49501 WP_001872319.1.49508 WP_001872319.1.49888 WP_001872319.1.49965 WP_001872319.1.50326 WP_001872319.1.50352 WP_001872319.1.5055 WP_001872319.1.5063 WP_001872319.1.50874 WP_001872319.1.50880 WP_001872319.1.50943 WP_001872319.1.50959 WP_001872319.1.51004 WP_001872319.1.51102 WP_001872319.1.51114 WP_001872319.1.5137 WP_001872319.1.51570 WP_001872319.1.51780 WP_001872319.1.52273 WP_001872319.1.52634 WP_001872319.1.52729 WP_001872319.1.52826 WP_001872319.1.52916 WP_001872319.1.52981 WP_001872319.1.53087 WP_001872319.1.5384 WP_001872319.1.54107 WP_001872319.1.54228 WP_001872319.1.54244 WP_001872319.1.54416 WP_001872319.1.5451 WP_001872319.1.54629 WP_001872319.1.54752 WP_001872319.1.54818 WP_001872319.1.54821 WP_001872319.1.55451 WP_001872319.1.55655 WP_001872319.1.55702 WP_001872319.1.55753 WP_001872319.1.55878 WP_001872319.1.56043 WP_001872319.1.564 WP_001872319.1.56404 WP_001872319.1.56590 WP_001872319.1.56602 WP_001872319.1.56930 WP_001872319.1.57174 WP_001872319.1.57368 WP_001872319.1.57407 WP_001872319.1.57557 WP_001872319.1.57586 WP_001872319.1.57721 WP_001872319.1.57900 WP_001872319.1.58075 WP_001872319.1.58119 WP_001872319.1.58208 WP_001872319.1.58254 WP_001872319.1.59040 WP_001872319.1.59057 WP_001872319.1.59460 WP_001872319.1.59565 WP_001872319.1.5977 WP_001872319.1.5999 WP_001872319.1.60093 WP_001872319.1.60159 WP_001872319.1.6055 WP_001872319.1.60593 WP_001872319.1.61267 WP_001872319.1.61458 WP_001872319.1.61554 WP_001872319.1.61676 WP_001872319.1.61790 WP_001872319.1.61844 WP_001872319.1.62057 WP_001872319.1.62267 WP_001872319.1.62362 WP_001872319.1.62758 WP_001872319.1.6321 WP_001872319.1.63363 WP_001872319.1.63367 WP_001872319.1.63482 WP_001872319.1.6360 WP_001872319.1.63764 WP_001872319.1.63980 WP_001872319.1.64297 WP_001872319.1.64459 WP_001872319.1.64468 WP_001872319.1.64560 WP_001872319.1.64640 WP_001872319.1.64651 WP_001872319.1.64713 WP_001872319.1.64967 WP_001872319.1.64975 WP_001872319.1.65195 WP_001872319.1.6526 WP_001872319.1.65297 WP_001872319.1.65323 WP_001872319.1.65324 WP_001872319.1.65427 WP_001872319.1.6564 WP_001872319.1.65668 WP_001872319.1.65918 WP_001872319.1.66063 WP_001872319.1.66242 WP_001872319.1.67008 WP_001872319.1.67162 WP_001872319.1.67318 WP_001872319.1.67444 WP_001872319.1.67476 WP_001872319.1.67680 WP_001872319.1.67759 WP_001872319.1.67859 WP_001872319.1.68234 WP_001872319.1.68290 WP_001872319.1.6840 WP_001872319.1.68413 WP_001872319.1.68443 WP_001872319.1.68587 WP_001872319.1.68732 WP_001872319.1.68788 WP_001872319.1.68827 WP_001872319.1.68890 WP_001872319.1.69023 WP_001872319.1.69077 WP_001872319.1.69101 WP_001872319.1.69132 WP_001872319.1.69163 WP_001872319.1.6986 WP_001872319.1.70219 WP_001872319.1.70276 WP_001872319.1.70286 WP_001872319.1.70391 WP_001872319.1.70397 WP_001872319.1.70742 WP_001872319.1.70932 WP_001872319.1.71044 WP_001872319.1.71075 WP_001872319.1.71237 WP_001872319.1.71554 WP_001872319.1.71606 WP_001872319.1.71643 WP_001872319.1.71709 WP_001872319.1.7191 WP_001872319.1.7234 WP_001872319.1.72381 WP_001872319.1.72464 WP_001872319.1.72821 WP_001872319.1.72949 WP_001872319.1.73030 WP_001872319.1.73082 WP_001872319.1.73137 WP_001872319.1.73417 WP_001872319.1.73449 WP_001872319.1.73585 WP_001872319.1.73637 WP_001872319.1.73692 WP_001872319.1.73696 WP_001872319.1.73856 WP_001872319.1.74086 WP_001872319.1.74179 WP_001872319.1.74188 WP_001872319.1.74717 WP_001872319.1.74933 WP_001872319.1.74951 WP_001872319.1.75020 WP_001872319.1.75077 WP_001872319.1.75293 WP_001872319.1.7586 WP_001872319.1.75882 WP_001872319.1.76034 WP_001872319.1.7620 WP_001872319.1.76408 WP_001872319.1.76610 WP_001872319.1.76906 WP_001872319.1.76996 WP_001872319.1.77005 WP_001872319.1.77300 WP_001872319.1.77757 WP_001872319.1.77945 WP_001872319.1.78006 WP_001872319.1.78251 WP_001872319.1.78262 WP_001872319.1.78292 WP_001872319.1.7835 WP_001872319.1.78356 WP_001872319.1.78432 WP_001872319.1.78464 WP_001872319.1.7882 WP_001872319.1.7904 WP_001872319.1.79135 WP_001872319.1.79474 WP_001872319.1.79724 WP_001872319.1.80180 WP_001872319.1.80460 WP_001872319.1.80706 WP_001872319.1.81006 WP_001872319.1.81080 WP_001872319.1.81115 WP_001872319.1.81168 WP_001872319.1.81280 WP_001872319.1.81303 WP_001872319.1.81506 WP_001872319.1.82198 WP_001872319.1.82293 WP_001872319.1.825 WP_001872319.1.82501 WP_001872319.1.82541 WP_001872319.1.82730 WP_001872319.1.83071 WP_001872319.1.83198 WP_001872319.1.83465 WP_001872319.1.83616 WP_001872319.1.8362 WP_001872319.1.84093 WP_001872319.1.84119 WP_001872319.1.84227 WP_001872319.1.84273 WP_001872319.1.84289 WP_001872319.1.84343 WP_001872319.1.85179 WP_001872319.1.852 WP_001872319.1.85296 WP_001872319.1.85914 WP_001872319.1.85946 WP_001872319.1.85966 WP_001872319.1.86366 WP_001872319.1.86497 WP_001872319.1.86500 WP_001872319.1.86532 WP_001872319.1.86535 WP_001872319.1.86651 WP_001872319.1.86972 WP_001872319.1.86986 WP_001872319.1.87011 WP_001872319.1.87030 WP_001872319.1.87033 WP_001872319.1.87251 WP_001872319.1.87307 WP_001872319.1.87380 WP_001872319.1.87395 WP_001872319.1.87807 WP_001872319.1.87880 WP_001872319.1.87882 WP_001872319.1.88071 WP_001872319.1.88209 WP_001872319.1.88296 WP_001872319.1.88344 WP_001872319.1.88345 WP_001872319.1.88429 WP_001872319.1.887 WP_001872319.1.88701 WP_001872319.1.88855 WP_001872319.1.89132 WP_001872319.1.89248 WP_001872319.1.89303 WP_001872319.1.89336 WP_001872319.1.89477 WP_001872319.1.89574 WP_001872319.1.89608 WP_001872319.1.90019 WP_001872319.1.90068 WP_001872319.1.90074 WP_001872319.1.90214 WP_001872319.1.90411 WP_001872319.1.90530 WP_001872319.1.90664 WP_001872319.1.90666 WP_001872319.1.90867 WP_001872319.1.90941 WP_001872319.1.9099 WP_001872319.1.91002 WP_001872319.1.91223 WP_001872319.1.91270 WP_001872319.1.91285 WP_001872319.1.9136 WP_001872319.1.91673 WP_001872319.1.91731 WP_001872319.1.92126 WP_001872319.1.92152 WP_001872319.1.92184 WP_001872319.1.92219 WP_001872319.1.92320 WP_001872319.1.92547 WP_001872319.1.92590 WP_001872319.1.92647 WP_001872319.1.92684 WP_001872319.1.92762 WP_001872319.1.9295 WP_001872319.1.93080 WP_001872319.1.933 WP_001872319.1.93303 WP_001872319.1.93537 WP_001872319.1.93734 WP_001872319.1.93793 WP_001872319.1.93825 WP_001872319.1.9386 WP_001872319.1.93881 WP_001872319.1.93884 WP_001872319.1.94109 WP_001872319.1.94346 WP_001872319.1.94370 WP_001872319.1.94532 WP_001872319.1.94803 WP_001872319.1.94973 WP_001872319.1.95950 WP_001872319.1.96087 WP_001872319.1.96116 WP_001872319.1.96137 WP_001872319.1.96406 WP_001872319.1.96485 WP_001872319.1.96768 WP_001872319.1.96868 WP_001872319.1.96943 WP_001872319.1.96986 WP_001872319.1.9711 WP_001872319.1.97166 WP_001872319.1.9741 WP_001872319.1.97621 WP_001872319.1.97836 WP_001872319.1.97838 WP_001872319.1.97850 WP_001872319.1.98063 WP_001872319.1.98185 WP_001872319.1.9822 WP_001872319.1.98264 WP_001872319.1.98346 WP_001872319.1.98370 WP_001872319.1.98638 WP_001872319.1.98766 WP_001872319.1.98773 WP_001872319.1.98832 WP_001872319.1.98979 WP_001872319.1.99017 WP_001872319.1.99019 WP_001872319.1.99056 WP_001872319.1.99241 WP_001872319.1.99286 WP_001872319.1.99447 gi|410594387|ref|YP_006951114.1| 377503 gi|22536994|ref|NP_687845.1| 205921.SAK_0953 208435.SAG0830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]