SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76787521|ref|YP_329308.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76787521|ref|YP_329308.1|
Domain Number 1 Region: 121-442
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.16e-89
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000151
Further Details:      
 
Domain Number 2 Region: 12-113
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.22e-19
Family Anticodon-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76787521|ref|YP_329308.1|
Sequence length 448
Comment asparaginyl-tRNA synthetase [Streptococcus agalactiae A909]
Sequence
MSKKLISIVDVKDYVGQEVTIGAWVANKSGKGKIAFVQLRDGSAFFQGVAFKPNFIEKYG
EESGLEKFDVIKRLNQETSVYVTGIVKEDERSKFGYELDITDLEVIGESHEYPITPKEHG
TDFLMDNRHLWLRSRKQMAVMQIRNAIIYSTYEFFDQNGFIKFDSPILSENAAEDSTELF
ETDYFGKPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFL
SHEESLDLQEAYVKALIQGVLDRAPQALDILERDVEALKRYIAEPFKRVSYDDAITLLQE
HEADEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYPASFKAFYMKPVPGNPERVLC
ADLLAPEGYGEIIGGSMREDDYDALVAKMDELGMDKSEYDFYLDLRKYGSVPHGGFGIGI
ERMVTFVAGTKHIREAIPFPRMLHRIKP
Download sequence
Identical sequences A0A0E1EKH3 A0A1F0CB50 F8XZ09 P67573 P67574 Q3K2E5 S8NMI7 S8Q855 S8Q8J3 S9CQ61 S9KHS8
gi|22536704|ref|NP_687555.1| 205921.SAK_0677 208435.SAG0526 211110.gbs0572 NP_687555.1.71890 WP_000038470.1.100037 WP_000038470.1.100058 WP_000038470.1.100093 WP_000038470.1.100254 WP_000038470.1.100267 WP_000038470.1.100296 WP_000038470.1.100355 WP_000038470.1.100367 WP_000038470.1.100520 WP_000038470.1.100641 WP_000038470.1.100766 WP_000038470.1.100913 WP_000038470.1.100991 WP_000038470.1.101222 WP_000038470.1.101267 WP_000038470.1.101319 WP_000038470.1.101328 WP_000038470.1.101938 WP_000038470.1.101956 WP_000038470.1.102056 WP_000038470.1.10297 WP_000038470.1.10371 WP_000038470.1.10618 WP_000038470.1.10645 WP_000038470.1.10924 WP_000038470.1.11248 WP_000038470.1.11446 WP_000038470.1.11465 WP_000038470.1.1163 WP_000038470.1.11756 WP_000038470.1.11774 WP_000038470.1.12072 WP_000038470.1.12166 WP_000038470.1.12215 WP_000038470.1.12688 WP_000038470.1.12755 WP_000038470.1.12978 WP_000038470.1.13008 WP_000038470.1.13064 WP_000038470.1.13285 WP_000038470.1.13384 WP_000038470.1.13553 WP_000038470.1.13658 WP_000038470.1.13737 WP_000038470.1.14040 WP_000038470.1.14140 WP_000038470.1.14324 WP_000038470.1.14368 WP_000038470.1.1437 WP_000038470.1.14953 WP_000038470.1.14960 WP_000038470.1.15199 WP_000038470.1.15385 WP_000038470.1.15526 WP_000038470.1.15556 WP_000038470.1.15760 WP_000038470.1.16134 WP_000038470.1.16528 WP_000038470.1.16535 WP_000038470.1.16580 WP_000038470.1.16595 WP_000038470.1.16706 WP_000038470.1.1681 WP_000038470.1.1696 WP_000038470.1.17056 WP_000038470.1.17074 WP_000038470.1.17380 WP_000038470.1.17489 WP_000038470.1.17506 WP_000038470.1.1760 WP_000038470.1.17707 WP_000038470.1.17709 WP_000038470.1.17815 WP_000038470.1.18047 WP_000038470.1.18263 WP_000038470.1.18425 WP_000038470.1.18450 WP_000038470.1.18829 WP_000038470.1.18841 WP_000038470.1.18933 WP_000038470.1.19892 WP_000038470.1.19950 WP_000038470.1.20123 WP_000038470.1.20188 WP_000038470.1.20326 WP_000038470.1.20350 WP_000038470.1.20435 WP_000038470.1.20717 WP_000038470.1.21061 WP_000038470.1.21522 WP_000038470.1.21525 WP_000038470.1.21669 WP_000038470.1.21860 WP_000038470.1.2195 WP_000038470.1.22004 WP_000038470.1.22139 WP_000038470.1.22247 WP_000038470.1.22552 WP_000038470.1.22801 WP_000038470.1.23126 WP_000038470.1.23380 WP_000038470.1.23508 WP_000038470.1.24162 WP_000038470.1.24441 WP_000038470.1.24475 WP_000038470.1.24845 WP_000038470.1.25002 WP_000038470.1.2509 WP_000038470.1.25182 WP_000038470.1.25647 WP_000038470.1.25949 WP_000038470.1.25985 WP_000038470.1.25998 WP_000038470.1.26029 WP_000038470.1.26046 WP_000038470.1.26056 WP_000038470.1.26174 WP_000038470.1.26258 WP_000038470.1.26300 WP_000038470.1.26312 WP_000038470.1.26357 WP_000038470.1.26386 WP_000038470.1.26786 WP_000038470.1.26791 WP_000038470.1.26827 WP_000038470.1.27318 WP_000038470.1.2754 WP_000038470.1.27880 WP_000038470.1.28630 WP_000038470.1.29020 WP_000038470.1.29163 WP_000038470.1.29238 WP_000038470.1.29352 WP_000038470.1.29410 WP_000038470.1.29470 WP_000038470.1.29532 WP_000038470.1.29771 WP_000038470.1.29888 WP_000038470.1.30182 WP_000038470.1.3028 WP_000038470.1.30310 WP_000038470.1.30321 WP_000038470.1.30388 WP_000038470.1.30450 WP_000038470.1.30603 WP_000038470.1.30703 WP_000038470.1.30710 WP_000038470.1.3074 WP_000038470.1.3112 WP_000038470.1.31250 WP_000038470.1.3166 WP_000038470.1.31888 WP_000038470.1.31894 WP_000038470.1.31896 WP_000038470.1.31904 WP_000038470.1.32053 WP_000038470.1.32728 WP_000038470.1.32745 WP_000038470.1.33105 WP_000038470.1.33723 WP_000038470.1.34174 WP_000038470.1.34276 WP_000038470.1.34467 WP_000038470.1.34475 WP_000038470.1.34896 WP_000038470.1.34906 WP_000038470.1.34981 WP_000038470.1.35119 WP_000038470.1.35216 WP_000038470.1.35399 WP_000038470.1.3543 WP_000038470.1.35443 WP_000038470.1.35451 WP_000038470.1.35621 WP_000038470.1.35937 WP_000038470.1.36095 WP_000038470.1.36403 WP_000038470.1.36408 WP_000038470.1.3658 WP_000038470.1.36594 WP_000038470.1.36710 WP_000038470.1.36878 WP_000038470.1.36977 WP_000038470.1.37098 WP_000038470.1.37523 WP_000038470.1.37547 WP_000038470.1.37570 WP_000038470.1.38237 WP_000038470.1.38456 WP_000038470.1.38699 WP_000038470.1.3880 WP_000038470.1.38842 WP_000038470.1.39284 WP_000038470.1.3930 WP_000038470.1.3937 WP_000038470.1.39381 WP_000038470.1.39386 WP_000038470.1.3963 WP_000038470.1.39656 WP_000038470.1.39673 WP_000038470.1.40015 WP_000038470.1.40055 WP_000038470.1.40203 WP_000038470.1.40650 WP_000038470.1.40774 WP_000038470.1.40812 WP_000038470.1.41269 WP_000038470.1.41329 WP_000038470.1.41399 WP_000038470.1.41646 WP_000038470.1.41663 WP_000038470.1.41785 WP_000038470.1.4215 WP_000038470.1.42225 WP_000038470.1.42477 WP_000038470.1.42540 WP_000038470.1.42844 WP_000038470.1.43138 WP_000038470.1.43199 WP_000038470.1.43571 WP_000038470.1.43981 WP_000038470.1.44374 WP_000038470.1.4446 WP_000038470.1.44614 WP_000038470.1.44727 WP_000038470.1.44746 WP_000038470.1.44777 WP_000038470.1.44957 WP_000038470.1.45 WP_000038470.1.45103 WP_000038470.1.45150 WP_000038470.1.45540 WP_000038470.1.45551 WP_000038470.1.45733 WP_000038470.1.45782 WP_000038470.1.45790 WP_000038470.1.45896 WP_000038470.1.45976 WP_000038470.1.46043 WP_000038470.1.46747 WP_000038470.1.46790 WP_000038470.1.46992 WP_000038470.1.47485 WP_000038470.1.47497 WP_000038470.1.47584 WP_000038470.1.47678 WP_000038470.1.48239 WP_000038470.1.48416 WP_000038470.1.48502 WP_000038470.1.48518 WP_000038470.1.48557 WP_000038470.1.48592 WP_000038470.1.48911 WP_000038470.1.48916 WP_000038470.1.49082 WP_000038470.1.49280 WP_000038470.1.49371 WP_000038470.1.49421 WP_000038470.1.49423 WP_000038470.1.49501 WP_000038470.1.49508 WP_000038470.1.49689 WP_000038470.1.49888 WP_000038470.1.50186 WP_000038470.1.50352 WP_000038470.1.5055 WP_000038470.1.50552 WP_000038470.1.5063 WP_000038470.1.50776 WP_000038470.1.50880 WP_000038470.1.50943 WP_000038470.1.50959 WP_000038470.1.51004 WP_000038470.1.51102 WP_000038470.1.51114 WP_000038470.1.51125 WP_000038470.1.51570 WP_000038470.1.51780 WP_000038470.1.52470 WP_000038470.1.52634 WP_000038470.1.52729 WP_000038470.1.52916 WP_000038470.1.52981 WP_000038470.1.53080 WP_000038470.1.53087 WP_000038470.1.53549 WP_000038470.1.5384 WP_000038470.1.54107 WP_000038470.1.54156 WP_000038470.1.54228 WP_000038470.1.54244 WP_000038470.1.54487 WP_000038470.1.5451 WP_000038470.1.54629 WP_000038470.1.54752 WP_000038470.1.54757 WP_000038470.1.54818 WP_000038470.1.54821 WP_000038470.1.54844 WP_000038470.1.54896 WP_000038470.1.54978 WP_000038470.1.55451 WP_000038470.1.55643 WP_000038470.1.55655 WP_000038470.1.55702 WP_000038470.1.55753 WP_000038470.1.55775 WP_000038470.1.55878 WP_000038470.1.55921 WP_000038470.1.56011 WP_000038470.1.564 WP_000038470.1.56404 WP_000038470.1.56590 WP_000038470.1.56602 WP_000038470.1.56930 WP_000038470.1.57262 WP_000038470.1.57336 WP_000038470.1.57368 WP_000038470.1.57407 WP_000038470.1.57721 WP_000038470.1.57756 WP_000038470.1.57900 WP_000038470.1.58119 WP_000038470.1.58254 WP_000038470.1.58255 WP_000038470.1.58297 WP_000038470.1.58520 WP_000038470.1.58988 WP_000038470.1.59040 WP_000038470.1.59057 WP_000038470.1.59460 WP_000038470.1.59565 WP_000038470.1.5977 WP_000038470.1.59783 WP_000038470.1.59837 WP_000038470.1.5999 WP_000038470.1.60093 WP_000038470.1.60159 WP_000038470.1.60290 WP_000038470.1.6055 WP_000038470.1.60702 WP_000038470.1.61176 WP_000038470.1.61267 WP_000038470.1.6131 WP_000038470.1.61676 WP_000038470.1.61790 WP_000038470.1.61844 WP_000038470.1.62057 WP_000038470.1.62276 WP_000038470.1.62362 WP_000038470.1.63345 WP_000038470.1.63367 WP_000038470.1.63508 WP_000038470.1.6360 WP_000038470.1.63764 WP_000038470.1.6383 WP_000038470.1.64206 WP_000038470.1.64256 WP_000038470.1.64459 WP_000038470.1.64468 WP_000038470.1.64560 WP_000038470.1.64640 WP_000038470.1.64713 WP_000038470.1.64967 WP_000038470.1.64975 WP_000038470.1.65036 WP_000038470.1.6512 WP_000038470.1.65195 WP_000038470.1.6526 WP_000038470.1.65287 WP_000038470.1.65323 WP_000038470.1.65324 WP_000038470.1.65427 WP_000038470.1.6564 WP_000038470.1.65668 WP_000038470.1.65918 WP_000038470.1.66063 WP_000038470.1.66372 WP_000038470.1.66784 WP_000038470.1.67002 WP_000038470.1.67008 WP_000038470.1.67277 WP_000038470.1.67680 WP_000038470.1.67759 WP_000038470.1.67859 WP_000038470.1.68234 WP_000038470.1.68443 WP_000038470.1.68641 WP_000038470.1.68732 WP_000038470.1.68827 WP_000038470.1.68905 WP_000038470.1.69023 WP_000038470.1.69034 WP_000038470.1.69101 WP_000038470.1.69132 WP_000038470.1.69163 WP_000038470.1.69214 WP_000038470.1.6986 WP_000038470.1.70053 WP_000038470.1.7017 WP_000038470.1.70242 WP_000038470.1.70286 WP_000038470.1.70391 WP_000038470.1.70397 WP_000038470.1.70879 WP_000038470.1.70897 WP_000038470.1.70932 WP_000038470.1.71075 WP_000038470.1.71237 WP_000038470.1.71554 WP_000038470.1.71606 WP_000038470.1.71643 WP_000038470.1.71709 WP_000038470.1.72284 WP_000038470.1.72381 WP_000038470.1.72464 WP_000038470.1.72821 WP_000038470.1.72949 WP_000038470.1.73030 WP_000038470.1.73137 WP_000038470.1.73449 WP_000038470.1.73585 WP_000038470.1.73625 WP_000038470.1.73637 WP_000038470.1.73692 WP_000038470.1.73856 WP_000038470.1.74179 WP_000038470.1.74375 WP_000038470.1.74564 WP_000038470.1.74717 WP_000038470.1.74739 WP_000038470.1.74933 WP_000038470.1.75020 WP_000038470.1.75293 WP_000038470.1.7530 WP_000038470.1.75801 WP_000038470.1.75819 WP_000038470.1.7586 WP_000038470.1.75882 WP_000038470.1.76034 WP_000038470.1.7620 WP_000038470.1.76222 WP_000038470.1.76334 WP_000038470.1.76479 WP_000038470.1.76610 WP_000038470.1.76747 WP_000038470.1.77005 WP_000038470.1.77138 WP_000038470.1.77300 WP_000038470.1.77493 WP_000038470.1.77757 WP_000038470.1.77945 WP_000038470.1.78006 WP_000038470.1.78251 WP_000038470.1.78262 WP_000038470.1.78292 WP_000038470.1.7835 WP_000038470.1.78356 WP_000038470.1.78464 WP_000038470.1.78480 WP_000038470.1.78552 WP_000038470.1.7882 WP_000038470.1.78994 WP_000038470.1.79135 WP_000038470.1.79474 WP_000038470.1.79724 WP_000038470.1.80046 WP_000038470.1.80180 WP_000038470.1.80438 WP_000038470.1.80460 WP_000038470.1.80895 WP_000038470.1.8099 WP_000038470.1.81006 WP_000038470.1.81080 WP_000038470.1.81115 WP_000038470.1.81168 WP_000038470.1.81506 WP_000038470.1.82198 WP_000038470.1.82293 WP_000038470.1.825 WP_000038470.1.82501 WP_000038470.1.82541 WP_000038470.1.83071 WP_000038470.1.83198 WP_000038470.1.8340 WP_000038470.1.83429 WP_000038470.1.83465 WP_000038470.1.83616 WP_000038470.1.8362 WP_000038470.1.83723 WP_000038470.1.84093 WP_000038470.1.84119 WP_000038470.1.84227 WP_000038470.1.84273 WP_000038470.1.84289 WP_000038470.1.84707 WP_000038470.1.84909 WP_000038470.1.85015 WP_000038470.1.85179 WP_000038470.1.852 WP_000038470.1.85296 WP_000038470.1.8568 WP_000038470.1.85946 WP_000038470.1.85966 WP_000038470.1.8625 WP_000038470.1.86366 WP_000038470.1.86400 WP_000038470.1.86497 WP_000038470.1.86500 WP_000038470.1.86511 WP_000038470.1.86535 WP_000038470.1.86651 WP_000038470.1.86972 WP_000038470.1.87011 WP_000038470.1.87030 WP_000038470.1.87033 WP_000038470.1.87062 WP_000038470.1.87251 WP_000038470.1.87307 WP_000038470.1.87380 WP_000038470.1.87395 WP_000038470.1.87412 WP_000038470.1.87546 WP_000038470.1.87697 WP_000038470.1.87807 WP_000038470.1.87810 WP_000038470.1.87882 WP_000038470.1.88209 WP_000038470.1.88248 WP_000038470.1.88296 WP_000038470.1.88345 WP_000038470.1.88357 WP_000038470.1.88429 WP_000038470.1.887 WP_000038470.1.89132 WP_000038470.1.89248 WP_000038470.1.89303 WP_000038470.1.89336 WP_000038470.1.89838 WP_000038470.1.89890 WP_000038470.1.90068 WP_000038470.1.90074 WP_000038470.1.90136 WP_000038470.1.90411 WP_000038470.1.90530 WP_000038470.1.90666 WP_000038470.1.90867 WP_000038470.1.90941 WP_000038470.1.9099 WP_000038470.1.91002 WP_000038470.1.9125 WP_000038470.1.9136 WP_000038470.1.91731 WP_000038470.1.92126 WP_000038470.1.92152 WP_000038470.1.92184 WP_000038470.1.92219 WP_000038470.1.92547 WP_000038470.1.92590 WP_000038470.1.92684 WP_000038470.1.92811 WP_000038470.1.9295 WP_000038470.1.93080 WP_000038470.1.933 WP_000038470.1.93323 WP_000038470.1.93358 WP_000038470.1.93394 WP_000038470.1.93607 WP_000038470.1.93734 WP_000038470.1.93793 WP_000038470.1.93825 WP_000038470.1.9386 WP_000038470.1.93881 WP_000038470.1.93884 WP_000038470.1.94109 WP_000038470.1.94310 WP_000038470.1.94346 WP_000038470.1.94370 WP_000038470.1.94973 WP_000038470.1.95950 WP_000038470.1.95993 WP_000038470.1.96087 WP_000038470.1.96406 WP_000038470.1.96475 WP_000038470.1.96485 WP_000038470.1.96768 WP_000038470.1.96868 WP_000038470.1.96943 WP_000038470.1.9711 WP_000038470.1.9741 WP_000038470.1.97621 WP_000038470.1.97630 WP_000038470.1.97836 WP_000038470.1.97850 WP_000038470.1.98185 WP_000038470.1.98264 WP_000038470.1.98346 WP_000038470.1.98370 WP_000038470.1.98773 WP_000038470.1.99017 WP_000038470.1.99019 WP_000038470.1.99149 WP_000038470.1.99241 WP_000038470.1.99286 WP_000038470.1.99728 WP_000038470.1.99946 gi|25010641|ref|NP_735036.1| gi|406709058|ref|YP_006763784.1| gi|76787521|ref|YP_329308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]