SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76787676|ref|YP_330269.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76787676|ref|YP_330269.1|
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.39e-26
Family DNA-binding N-terminal domain of transcription activators 0.00018
Further Details:      
 
Domain Number 2 Region: 149-236
Classification Level Classification E-value
Superfamily Antibiotic binding domain of TipA-like multidrug resistance regulators 3.4e-24
Family Antibiotic binding domain of TipA-like multidrug resistance regulators 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76787676|ref|YP_330269.1|
Sequence length 237
Comment MerR family transcriptional regulator [Streptococcus agalactiae A909]
Sequence
MKTVKEISHISGISVRTLHYYDEIDLLSPSFVGENGYRYYDDESLIKLQEILLFKELEFP
LKKIKEIMDSPNYDRNQALLDQIRWLELKKQRLEEVIEHAKSIQRGKNMSDFTAYNQEEL
EAFQEEARTRWGDTDSYKEFENSHSKNDFSMISQAMSQIFKDFGQLKELSPTDEKVQKQV
QILQDYITAQFYNCTNDLLASLGIMYIQDERFQKSIDNWGGQGTALFVSKAIDSYCH
Download sequence
Identical sequences A0A0E1EJ13 A0A1F0CGC3 Q8DY38
NP_688646.1.71890 WP_000859559.1.100037 WP_000859559.1.100254 WP_000859559.1.100367 WP_000859559.1.100766 WP_000859559.1.101222 WP_000859559.1.101267 WP_000859559.1.101956 WP_000859559.1.10618 WP_000859559.1.10924 WP_000859559.1.11465 WP_000859559.1.12166 WP_000859559.1.12755 WP_000859559.1.12978 WP_000859559.1.13008 WP_000859559.1.13064 WP_000859559.1.13384 WP_000859559.1.13553 WP_000859559.1.13737 WP_000859559.1.14324 WP_000859559.1.15417 WP_000859559.1.15526 WP_000859559.1.15556 WP_000859559.1.16134 WP_000859559.1.16535 WP_000859559.1.16706 WP_000859559.1.18047 WP_000859559.1.18425 WP_000859559.1.18841 WP_000859559.1.18933 WP_000859559.1.19892 WP_000859559.1.19950 WP_000859559.1.20188 WP_000859559.1.20326 WP_000859559.1.20791 WP_000859559.1.21669 WP_000859559.1.22004 WP_000859559.1.22139 WP_000859559.1.22247 WP_000859559.1.22801 WP_000859559.1.23380 WP_000859559.1.24441 WP_000859559.1.24475 WP_000859559.1.25998 WP_000859559.1.26056 WP_000859559.1.26258 WP_000859559.1.26300 WP_000859559.1.26357 WP_000859559.1.26827 WP_000859559.1.2754 WP_000859559.1.29020 WP_000859559.1.29163 WP_000859559.1.29352 WP_000859559.1.29888 WP_000859559.1.30603 WP_000859559.1.30710 WP_000859559.1.3074 WP_000859559.1.3166 WP_000859559.1.31888 WP_000859559.1.32728 WP_000859559.1.32745 WP_000859559.1.33723 WP_000859559.1.34276 WP_000859559.1.34467 WP_000859559.1.34475 WP_000859559.1.34906 WP_000859559.1.35216 WP_000859559.1.35443 WP_000859559.1.36726 WP_000859559.1.36878 WP_000859559.1.36977 WP_000859559.1.37523 WP_000859559.1.37570 WP_000859559.1.38699 WP_000859559.1.38910 WP_000859559.1.3930 WP_000859559.1.3937 WP_000859559.1.39386 WP_000859559.1.3963 WP_000859559.1.40203 WP_000859559.1.41269 WP_000859559.1.41399 WP_000859559.1.41646 WP_000859559.1.42225 WP_000859559.1.42844 WP_000859559.1.43199 WP_000859559.1.44957 WP_000859559.1.45103 WP_000859559.1.45150 WP_000859559.1.45540 WP_000859559.1.45790 WP_000859559.1.45896 WP_000859559.1.45976 WP_000859559.1.46992 WP_000859559.1.47485 WP_000859559.1.48239 WP_000859559.1.49082 WP_000859559.1.49421 WP_000859559.1.49423 WP_000859559.1.49888 WP_000859559.1.5055 WP_000859559.1.50639 WP_000859559.1.51102 WP_000859559.1.51114 WP_000859559.1.51570 WP_000859559.1.51780 WP_000859559.1.52401 WP_000859559.1.52729 WP_000859559.1.52981 WP_000859559.1.53087 WP_000859559.1.54107 WP_000859559.1.54228 WP_000859559.1.5451 WP_000859559.1.54629 WP_000859559.1.54752 WP_000859559.1.54821 WP_000859559.1.55451 WP_000859559.1.55655 WP_000859559.1.56404 WP_000859559.1.56602 WP_000859559.1.56930 WP_000859559.1.57262 WP_000859559.1.58119 WP_000859559.1.58254 WP_000859559.1.59040 WP_000859559.1.59057 WP_000859559.1.59460 WP_000859559.1.59565 WP_000859559.1.5977 WP_000859559.1.5999 WP_000859559.1.60093 WP_000859559.1.60159 WP_000859559.1.60702 WP_000859559.1.61267 WP_000859559.1.61790 WP_000859559.1.61844 WP_000859559.1.62057 WP_000859559.1.62267 WP_000859559.1.62362 WP_000859559.1.63367 WP_000859559.1.63764 WP_000859559.1.64206 WP_000859559.1.64459 WP_000859559.1.64468 WP_000859559.1.64713 WP_000859559.1.64967 WP_000859559.1.64975 WP_000859559.1.65323 WP_000859559.1.65427 WP_000859559.1.65668 WP_000859559.1.66063 WP_000859559.1.67008 WP_000859559.1.67759 WP_000859559.1.67859 WP_000859559.1.68788 WP_000859559.1.68827 WP_000859559.1.69023 WP_000859559.1.69034 WP_000859559.1.69101 WP_000859559.1.69132 WP_000859559.1.69163 WP_000859559.1.6986 WP_000859559.1.70286 WP_000859559.1.70391 WP_000859559.1.70397 WP_000859559.1.70932 WP_000859559.1.71237 WP_000859559.1.71554 WP_000859559.1.71606 WP_000859559.1.71709 WP_000859559.1.72381 WP_000859559.1.72821 WP_000859559.1.73137 WP_000859559.1.73449 WP_000859559.1.73585 WP_000859559.1.73692 WP_000859559.1.73856 WP_000859559.1.74717 WP_000859559.1.74933 WP_000859559.1.75882 WP_000859559.1.76034 WP_000859559.1.7620 WP_000859559.1.76610 WP_000859559.1.77757 WP_000859559.1.77945 WP_000859559.1.78006 WP_000859559.1.78292 WP_000859559.1.79135 WP_000859559.1.79474 WP_000859559.1.80460 WP_000859559.1.81080 WP_000859559.1.81168 WP_000859559.1.81506 WP_000859559.1.82198 WP_000859559.1.82501 WP_000859559.1.83071 WP_000859559.1.83198 WP_000859559.1.8340 WP_000859559.1.83465 WP_000859559.1.83616 WP_000859559.1.8362 WP_000859559.1.84093 WP_000859559.1.84119 WP_000859559.1.84227 WP_000859559.1.84273 WP_000859559.1.85179 WP_000859559.1.85296 WP_000859559.1.85966 WP_000859559.1.8625 WP_000859559.1.86535 WP_000859559.1.86651 WP_000859559.1.87011 WP_000859559.1.87033 WP_000859559.1.87307 WP_000859559.1.87395 WP_000859559.1.87807 WP_000859559.1.88296 WP_000859559.1.887 WP_000859559.1.89132 WP_000859559.1.89303 WP_000859559.1.89336 WP_000859559.1.90019 WP_000859559.1.90074 WP_000859559.1.90411 WP_000859559.1.90530 WP_000859559.1.90666 WP_000859559.1.90867 WP_000859559.1.90941 WP_000859559.1.9136 WP_000859559.1.91731 WP_000859559.1.92184 WP_000859559.1.92219 WP_000859559.1.92547 WP_000859559.1.92590 WP_000859559.1.9295 WP_000859559.1.93080 WP_000859559.1.933 WP_000859559.1.93793 WP_000859559.1.93825 WP_000859559.1.9386 WP_000859559.1.93881 WP_000859559.1.93884 WP_000859559.1.94346 WP_000859559.1.94370 WP_000859559.1.94973 WP_000859559.1.96087 WP_000859559.1.96406 WP_000859559.1.96943 WP_000859559.1.9711 WP_000859559.1.9741 WP_000859559.1.97621 WP_000859559.1.97836 WP_000859559.1.97850 WP_000859559.1.98185 WP_000859559.1.98370 WP_000859559.1.98773 WP_000859559.1.99017 WP_000859559.1.99447 205921.SAK_1667 208435.SAG1655 gi|406710034|ref|YP_006764760.1| gi|22537795|ref|NP_688646.1| gi|76787676|ref|YP_330269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]