SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76787725|ref|YP_329766.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76787725|ref|YP_329766.1|
Domain Number 1 Region: 13-251
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.55e-65
Family LplA-like 0.0000126
Further Details:      
 
Domain Number 2 Region: 252-338
Classification Level Classification E-value
Superfamily SufE/NifU 1.26e-23
Family SP1160 C-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76787725|ref|YP_329766.1|
Sequence length 339
Comment lipoate-protein ligase A [Streptococcus agalactiae A909]
Sequence
MYLIEPIRNGKRITDGAIALAMQVYILQNVFLDDDILFPYYCDPKVEIGKFQNAVIETNQ
EYLKEHDIPVVRRDTGGGAVYVDSGAVNICYLMKDHGQFGDFKRAYEPAIKALKTLGASS
VEMRGRNDLVIDGKKVSGAAMTIVNGRIYGGYSLLLDVDFDAMEKVLNPNRKKIESKGIK
SVRSRVGDIRSHLSEDYRHITTDQFKDLMVCQLLHIDHIDQAKRYHLTEKDWAAIDALAD
EKYKNWDWNYGNSPQYSYHRDARFPSGTYDFHLEIEKGIITNCRIYGDFFSSKDISDIEN
LLIGCPMKEELVLEKLSTLSLEDYFGQTSPEEIKAVLFS
Download sequence
Identical sequences A0A0H1U5F2 A0A1J7UWH6 E7S498 F8Y0G8 S8FK49 S8G073 S8G6X5 S9BH14 S9BPH8 S9CM10
WP_000280831.1.100058 WP_000280831.1.100093 WP_000280831.1.100267 WP_000280831.1.100296 WP_000280831.1.100355 WP_000280831.1.100367 WP_000280831.1.100520 WP_000280831.1.100641 WP_000280831.1.100766 WP_000280831.1.100913 WP_000280831.1.100991 WP_000280831.1.101208 WP_000280831.1.101222 WP_000280831.1.101267 WP_000280831.1.101328 WP_000280831.1.10297 WP_000280831.1.10371 WP_000280831.1.10620 WP_000280831.1.10645 WP_000280831.1.1067 WP_000280831.1.10676 WP_000280831.1.11248 WP_000280831.1.11343 WP_000280831.1.11446 WP_000280831.1.11465 WP_000280831.1.11774 WP_000280831.1.11941 WP_000280831.1.12072 WP_000280831.1.12166 WP_000280831.1.12249 WP_000280831.1.12363 WP_000280831.1.12688 WP_000280831.1.12755 WP_000280831.1.1293 WP_000280831.1.12978 WP_000280831.1.13064 WP_000280831.1.13167 WP_000280831.1.13493 WP_000280831.1.13885 WP_000280831.1.1402 WP_000280831.1.14040 WP_000280831.1.14140 WP_000280831.1.14368 WP_000280831.1.1437 WP_000280831.1.14429 WP_000280831.1.15199 WP_000280831.1.15385 WP_000280831.1.15417 WP_000280831.1.15526 WP_000280831.1.16134 WP_000280831.1.1633 WP_000280831.1.16528 WP_000280831.1.16535 WP_000280831.1.16580 WP_000280831.1.1681 WP_000280831.1.1696 WP_000280831.1.16976 WP_000280831.1.17243 WP_000280831.1.17380 WP_000280831.1.17506 WP_000280831.1.1760 WP_000280831.1.17815 WP_000280831.1.18003 WP_000280831.1.18263 WP_000280831.1.18362 WP_000280831.1.18450 WP_000280831.1.18747 WP_000280831.1.1882 WP_000280831.1.18841 WP_000280831.1.18933 WP_000280831.1.19086 WP_000280831.1.19892 WP_000280831.1.20188 WP_000280831.1.20350 WP_000280831.1.20435 WP_000280831.1.20458 WP_000280831.1.20717 WP_000280831.1.20791 WP_000280831.1.20847 WP_000280831.1.21061 WP_000280831.1.21087 WP_000280831.1.21280 WP_000280831.1.21525 WP_000280831.1.21860 WP_000280831.1.2195 WP_000280831.1.22004 WP_000280831.1.22076 WP_000280831.1.22087 WP_000280831.1.22552 WP_000280831.1.22749 WP_000280831.1.23126 WP_000280831.1.23380 WP_000280831.1.23508 WP_000280831.1.24162 WP_000280831.1.24296 WP_000280831.1.24441 WP_000280831.1.24475 WP_000280831.1.24559 WP_000280831.1.24827 WP_000280831.1.25002 WP_000280831.1.25182 WP_000280831.1.25303 WP_000280831.1.2555 WP_000280831.1.25670 WP_000280831.1.25949 WP_000280831.1.25973 WP_000280831.1.25985 WP_000280831.1.26056 WP_000280831.1.26153 WP_000280831.1.26174 WP_000280831.1.26786 WP_000280831.1.26791 WP_000280831.1.27184 WP_000280831.1.27318 WP_000280831.1.27325 WP_000280831.1.27751 WP_000280831.1.2781 WP_000280831.1.27880 WP_000280831.1.28197 WP_000280831.1.28342 WP_000280831.1.2844 WP_000280831.1.28613 WP_000280831.1.28624 WP_000280831.1.28630 WP_000280831.1.28991 WP_000280831.1.29163 WP_000280831.1.29238 WP_000280831.1.29352 WP_000280831.1.29410 WP_000280831.1.29470 WP_000280831.1.29532 WP_000280831.1.29771 WP_000280831.1.30182 WP_000280831.1.30200 WP_000280831.1.3028 WP_000280831.1.30310 WP_000280831.1.30321 WP_000280831.1.30388 WP_000280831.1.30450 WP_000280831.1.3052 WP_000280831.1.30703 WP_000280831.1.30710 WP_000280831.1.3074 WP_000280831.1.30831 WP_000280831.1.31250 WP_000280831.1.31888 WP_000280831.1.31894 WP_000280831.1.31896 WP_000280831.1.31904 WP_000280831.1.32053 WP_000280831.1.32511 WP_000280831.1.32728 WP_000280831.1.33105 WP_000280831.1.34174 WP_000280831.1.34276 WP_000280831.1.34467 WP_000280831.1.34475 WP_000280831.1.34828 WP_000280831.1.34906 WP_000280831.1.34981 WP_000280831.1.35119 WP_000280831.1.35399 WP_000280831.1.3543 WP_000280831.1.35451 WP_000280831.1.35621 WP_000280831.1.35908 WP_000280831.1.35937 WP_000280831.1.36095 WP_000280831.1.3658 WP_000280831.1.36594 WP_000280831.1.36710 WP_000280831.1.36726 WP_000280831.1.36776 WP_000280831.1.36878 WP_000280831.1.3691 WP_000280831.1.36977 WP_000280831.1.37124 WP_000280831.1.37523 WP_000280831.1.37547 WP_000280831.1.37692 WP_000280831.1.38237 WP_000280831.1.3845 WP_000280831.1.38456 WP_000280831.1.38699 WP_000280831.1.38910 WP_000280831.1.3927 WP_000280831.1.39284 WP_000280831.1.39381 WP_000280831.1.39386 WP_000280831.1.39495 WP_000280831.1.3963 WP_000280831.1.39673 WP_000280831.1.40055 WP_000280831.1.40241 WP_000280831.1.40538 WP_000280831.1.40650 WP_000280831.1.40694 WP_000280831.1.40765 WP_000280831.1.40774 WP_000280831.1.40812 WP_000280831.1.41329 WP_000280831.1.41338 WP_000280831.1.41399 WP_000280831.1.41663 WP_000280831.1.41785 WP_000280831.1.41865 WP_000280831.1.42540 WP_000280831.1.42686 WP_000280831.1.42844 WP_000280831.1.4323 WP_000280831.1.43571 WP_000280831.1.4446 WP_000280831.1.44614 WP_000280831.1.44727 WP_000280831.1.44746 WP_000280831.1.44777 WP_000280831.1.45 WP_000280831.1.45058 WP_000280831.1.45103 WP_000280831.1.45150 WP_000280831.1.45551 WP_000280831.1.45553 WP_000280831.1.45782 WP_000280831.1.45976 WP_000280831.1.46043 WP_000280831.1.46747 WP_000280831.1.47044 WP_000280831.1.47485 WP_000280831.1.47497 WP_000280831.1.47584 WP_000280831.1.47678 WP_000280831.1.48120 WP_000280831.1.48239 WP_000280831.1.48416 WP_000280831.1.48502 WP_000280831.1.48518 WP_000280831.1.48592 WP_000280831.1.48911 WP_000280831.1.48916 WP_000280831.1.49278 WP_000280831.1.49280 WP_000280831.1.49371 WP_000280831.1.49501 WP_000280831.1.49689 WP_000280831.1.49965 WP_000280831.1.50186 WP_000280831.1.5019 WP_000280831.1.50352 WP_000280831.1.50420 WP_000280831.1.5055 WP_000280831.1.5063 WP_000280831.1.50639 WP_000280831.1.50880 WP_000280831.1.50943 WP_000280831.1.51004 WP_000280831.1.51102 WP_000280831.1.51114 WP_000280831.1.51547 WP_000280831.1.51780 WP_000280831.1.52401 WP_000280831.1.52470 WP_000280831.1.52514 WP_000280831.1.53013 WP_000280831.1.53080 WP_000280831.1.53549 WP_000280831.1.5384 WP_000280831.1.54156 WP_000280831.1.54244 WP_000280831.1.5437 WP_000280831.1.54757 WP_000280831.1.54818 WP_000280831.1.54844 WP_000280831.1.54978 WP_000280831.1.55542 WP_000280831.1.55643 WP_000280831.1.55673 WP_000280831.1.55702 WP_000280831.1.55775 WP_000280831.1.55878 WP_000280831.1.55921 WP_000280831.1.56011 WP_000280831.1.56043 WP_000280831.1.56192 WP_000280831.1.56208 WP_000280831.1.56404 WP_000280831.1.56590 WP_000280831.1.56602 WP_000280831.1.56930 WP_000280831.1.57320 WP_000280831.1.57347 WP_000280831.1.57368 WP_000280831.1.57721 WP_000280831.1.57756 WP_000280831.1.57900 WP_000280831.1.58255 WP_000280831.1.58297 WP_000280831.1.58313 WP_000280831.1.58520 WP_000280831.1.59196 WP_000280831.1.59565 WP_000280831.1.5977 WP_000280831.1.59783 WP_000280831.1.59837 WP_000280831.1.60058 WP_000280831.1.60290 WP_000280831.1.6055 WP_000280831.1.6096 WP_000280831.1.61032 WP_000280831.1.61176 WP_000280831.1.61267 WP_000280831.1.6131 WP_000280831.1.61433 WP_000280831.1.61554 WP_000280831.1.61581 WP_000280831.1.61790 WP_000280831.1.62362 WP_000280831.1.63086 WP_000280831.1.63345 WP_000280831.1.63394 WP_000280831.1.63764 WP_000280831.1.6383 WP_000280831.1.64256 WP_000280831.1.64459 WP_000280831.1.64468 WP_000280831.1.64560 WP_000280831.1.64640 WP_000280831.1.65059 WP_000280831.1.6512 WP_000280831.1.65139 WP_000280831.1.6526 WP_000280831.1.65287 WP_000280831.1.65323 WP_000280831.1.65324 WP_000280831.1.65918 WP_000280831.1.66372 WP_000280831.1.66680 WP_000280831.1.66732 WP_000280831.1.66784 WP_000280831.1.67002 WP_000280831.1.67008 WP_000280831.1.67680 WP_000280831.1.67759 WP_000280831.1.68143 WP_000280831.1.68234 WP_000280831.1.68788 WP_000280831.1.68827 WP_000280831.1.68867 WP_000280831.1.68890 WP_000280831.1.68905 WP_000280831.1.69023 WP_000280831.1.69101 WP_000280831.1.69132 WP_000280831.1.69214 WP_000280831.1.69705 WP_000280831.1.70053 WP_000280831.1.7017 WP_000280831.1.70242 WP_000280831.1.70276 WP_000280831.1.70286 WP_000280831.1.70397 WP_000280831.1.70562 WP_000280831.1.71075 WP_000280831.1.71554 WP_000280831.1.71643 WP_000280831.1.72284 WP_000280831.1.72949 WP_000280831.1.73030 WP_000280831.1.73137 WP_000280831.1.73421 WP_000280831.1.7350 WP_000280831.1.73621 WP_000280831.1.73625 WP_000280831.1.74179 WP_000280831.1.74375 WP_000280831.1.74739 WP_000280831.1.7530 WP_000280831.1.75801 WP_000280831.1.75819 WP_000280831.1.7586 WP_000280831.1.7587 WP_000280831.1.76023 WP_000280831.1.76033 WP_000280831.1.76222 WP_000280831.1.76334 WP_000280831.1.76479 WP_000280831.1.76490 WP_000280831.1.76610 WP_000280831.1.77300 WP_000280831.1.77493 WP_000280831.1.78262 WP_000280831.1.7835 WP_000280831.1.78356 WP_000280831.1.78480 WP_000280831.1.78552 WP_000280831.1.78990 WP_000280831.1.78994 WP_000280831.1.7904 WP_000280831.1.791 WP_000280831.1.79117 WP_000280831.1.79135 WP_000280831.1.79372 WP_000280831.1.80180 WP_000280831.1.80340 WP_000280831.1.80438 WP_000280831.1.80895 WP_000280831.1.8099 WP_000280831.1.81006 WP_000280831.1.81115 WP_000280831.1.81168 WP_000280831.1.81506 WP_000280831.1.825 WP_000280831.1.82541 WP_000280831.1.82982 WP_000280831.1.8340 WP_000280831.1.83429 WP_000280831.1.83494 WP_000280831.1.83616 WP_000280831.1.83723 WP_000280831.1.84227 WP_000280831.1.84707 WP_000280831.1.85015 WP_000280831.1.85030 WP_000280831.1.85179 WP_000280831.1.852 WP_000280831.1.85605 WP_000280831.1.8568 WP_000280831.1.86366 WP_000280831.1.86400 WP_000280831.1.86497 WP_000280831.1.86500 WP_000280831.1.86511 WP_000280831.1.86532 WP_000280831.1.86635 WP_000280831.1.86972 WP_000280831.1.87030 WP_000280831.1.87033 WP_000280831.1.87062 WP_000280831.1.87251 WP_000280831.1.87307 WP_000280831.1.87380 WP_000280831.1.87546 WP_000280831.1.87807 WP_000280831.1.87810 WP_000280831.1.87882 WP_000280831.1.88209 WP_000280831.1.88345 WP_000280831.1.88357 WP_000280831.1.88429 WP_000280831.1.8861 WP_000280831.1.887 WP_000280831.1.88701 WP_000280831.1.88744 WP_000280831.1.89248 WP_000280831.1.89303 WP_000280831.1.89838 WP_000280831.1.89890 WP_000280831.1.90129 WP_000280831.1.90530 WP_000280831.1.90666 WP_000280831.1.90749 WP_000280831.1.90941 WP_000280831.1.9099 WP_000280831.1.91002 WP_000280831.1.9125 WP_000280831.1.91270 WP_000280831.1.92126 WP_000280831.1.92152 WP_000280831.1.92811 WP_000280831.1.933 WP_000280831.1.93323 WP_000280831.1.93358 WP_000280831.1.93394 WP_000280831.1.93607 WP_000280831.1.93734 WP_000280831.1.9386 WP_000280831.1.94109 WP_000280831.1.94194 WP_000280831.1.94310 WP_000280831.1.94370 WP_000280831.1.94457 WP_000280831.1.94868 WP_000280831.1.95328 WP_000280831.1.95394 WP_000280831.1.95658 WP_000280831.1.95950 WP_000280831.1.95993 WP_000280831.1.96026 WP_000280831.1.96087 WP_000280831.1.96116 WP_000280831.1.96137 WP_000280831.1.96475 WP_000280831.1.96485 WP_000280831.1.96986 WP_000280831.1.97630 WP_000280831.1.97836 WP_000280831.1.97850 WP_000280831.1.98584 WP_000280831.1.98638 WP_000280831.1.98832 WP_000280831.1.99149 WP_000280831.1.99241 WP_000280831.1.99447 WP_000280831.1.99728 gi|76787725|ref|YP_329766.1| 205921.SAK_1145 gi|512698504|ref|YP_008117789.1| gi|406709513|ref|YP_006764239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]