SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76787984|ref|YP_329077.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76787984|ref|YP_329077.1|
Domain Number 1 Region: 117-417
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.09e-109
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000049
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.83e-27
Family Seryl-tRNA synthetase (SerRS) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76787984|ref|YP_329077.1|
Sequence length 425
Comment seryl-tRNA synthetase [Streptococcus agalactiae A909]
Sequence
MLDLKRIRTDFDVVAKKLATRGVDQETLTTLKELDIKRRELLIKAEEAKAQRNVASAAIA
QAKRNKENADEQIAAMQTLSADIKAIDAELADVDANLQSMVTVLPNTPADDVPLGADEDE
NVEVRRWGTPREFDFETKAHWDLGESLGILDWERGAKVTGSRFLFYKGLGARLERAIYSF
MLDEHAKEGYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELADSPFVLIPTAEVPLTNYYR
DEIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYQELEK
MTANAENILQKLNLPYRVITLCTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTEDFQA
RRAQIRYRDEVDGKVRLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMGNID
IIKPN
Download sequence
Identical sequences A0A076Z928 A0A1F0CA42 P67565 P67566 Q3K326
NP_687390.1.71890 WP_000886193.1.100037 WP_000886193.1.100254 WP_000886193.1.10029 WP_000886193.1.100367 WP_000886193.1.100766 WP_000886193.1.101195 WP_000886193.1.101222 WP_000886193.1.101267 WP_000886193.1.101296 WP_000886193.1.101319 WP_000886193.1.101830 WP_000886193.1.101853 WP_000886193.1.101864 WP_000886193.1.101956 WP_000886193.1.10371 WP_000886193.1.10618 WP_000886193.1.10723 WP_000886193.1.10924 WP_000886193.1.11465 WP_000886193.1.1163 WP_000886193.1.11756 WP_000886193.1.12102 WP_000886193.1.12166 WP_000886193.1.12331 WP_000886193.1.1251 WP_000886193.1.12619 WP_000886193.1.12688 WP_000886193.1.12755 WP_000886193.1.12978 WP_000886193.1.13008 WP_000886193.1.13064 WP_000886193.1.13285 WP_000886193.1.13384 WP_000886193.1.13553 WP_000886193.1.13737 WP_000886193.1.14275 WP_000886193.1.14324 WP_000886193.1.14563 WP_000886193.1.14738 WP_000886193.1.14953 WP_000886193.1.14960 WP_000886193.1.15417 WP_000886193.1.15526 WP_000886193.1.15556 WP_000886193.1.16134 WP_000886193.1.16165 WP_000886193.1.16342 WP_000886193.1.16535 WP_000886193.1.16595 WP_000886193.1.16706 WP_000886193.1.17056 WP_000886193.1.17339 WP_000886193.1.17489 WP_000886193.1.1760 WP_000886193.1.1775 WP_000886193.1.18047 WP_000886193.1.18425 WP_000886193.1.18450 WP_000886193.1.18829 WP_000886193.1.18841 WP_000886193.1.18933 WP_000886193.1.19604 WP_000886193.1.19892 WP_000886193.1.19950 WP_000886193.1.20123 WP_000886193.1.20188 WP_000886193.1.20326 WP_000886193.1.20511 WP_000886193.1.20791 WP_000886193.1.20847 WP_000886193.1.21522 WP_000886193.1.21525 WP_000886193.1.21669 WP_000886193.1.21722 WP_000886193.1.21779 WP_000886193.1.22004 WP_000886193.1.22139 WP_000886193.1.222 WP_000886193.1.22247 WP_000886193.1.22801 WP_000886193.1.23380 WP_000886193.1.23384 WP_000886193.1.24441 WP_000886193.1.24475 WP_000886193.1.24845 WP_000886193.1.25647 WP_000886193.1.25781 WP_000886193.1.25998 WP_000886193.1.26046 WP_000886193.1.26056 WP_000886193.1.26258 WP_000886193.1.26357 WP_000886193.1.2651 WP_000886193.1.26791 WP_000886193.1.26827 WP_000886193.1.27024 WP_000886193.1.2754 WP_000886193.1.27583 WP_000886193.1.27880 WP_000886193.1.27958 WP_000886193.1.28021 WP_000886193.1.28738 WP_000886193.1.29020 WP_000886193.1.29163 WP_000886193.1.29352 WP_000886193.1.29719 WP_000886193.1.29888 WP_000886193.1.30062 WP_000886193.1.30252 WP_000886193.1.30603 WP_000886193.1.30703 WP_000886193.1.30710 WP_000886193.1.3074 WP_000886193.1.31109 WP_000886193.1.3112 WP_000886193.1.3166 WP_000886193.1.31888 WP_000886193.1.32520 WP_000886193.1.32728 WP_000886193.1.32745 WP_000886193.1.32818 WP_000886193.1.33723 WP_000886193.1.34227 WP_000886193.1.34276 WP_000886193.1.34467 WP_000886193.1.34475 WP_000886193.1.34896 WP_000886193.1.34906 WP_000886193.1.35216 WP_000886193.1.35428 WP_000886193.1.35443 WP_000886193.1.36095 WP_000886193.1.36202 WP_000886193.1.36258 WP_000886193.1.36408 WP_000886193.1.36878 WP_000886193.1.36977 WP_000886193.1.37018 WP_000886193.1.37098 WP_000886193.1.37523 WP_000886193.1.37570 WP_000886193.1.3814 WP_000886193.1.38578 WP_000886193.1.3880 WP_000886193.1.38842 WP_000886193.1.38910 WP_000886193.1.3930 WP_000886193.1.3937 WP_000886193.1.39386 WP_000886193.1.3963 WP_000886193.1.40015 WP_000886193.1.40203 WP_000886193.1.40359 WP_000886193.1.41269 WP_000886193.1.41399 WP_000886193.1.41646 WP_000886193.1.41663 WP_000886193.1.41785 WP_000886193.1.4215 WP_000886193.1.42225 WP_000886193.1.42271 WP_000886193.1.42844 WP_000886193.1.43138 WP_000886193.1.43199 WP_000886193.1.44371 WP_000886193.1.44374 WP_000886193.1.44712 WP_000886193.1.44727 WP_000886193.1.44746 WP_000886193.1.44957 WP_000886193.1.45 WP_000886193.1.45103 WP_000886193.1.45150 WP_000886193.1.45180 WP_000886193.1.45540 WP_000886193.1.45790 WP_000886193.1.45896 WP_000886193.1.45976 WP_000886193.1.46116 WP_000886193.1.46992 WP_000886193.1.47485 WP_000886193.1.47608 WP_000886193.1.48052 WP_000886193.1.48239 WP_000886193.1.48557 WP_000886193.1.49082 WP_000886193.1.49421 WP_000886193.1.49423 WP_000886193.1.49508 WP_000886193.1.49888 WP_000886193.1.50326 WP_000886193.1.5055 WP_000886193.1.50552 WP_000886193.1.50776 WP_000886193.1.50874 WP_000886193.1.51102 WP_000886193.1.51114 WP_000886193.1.51570 WP_000886193.1.51780 WP_000886193.1.52273 WP_000886193.1.52470 WP_000886193.1.52634 WP_000886193.1.52729 WP_000886193.1.52826 WP_000886193.1.52916 WP_000886193.1.52981 WP_000886193.1.53087 WP_000886193.1.54107 WP_000886193.1.54228 WP_000886193.1.54416 WP_000886193.1.54423 WP_000886193.1.54487 WP_000886193.1.5451 WP_000886193.1.54629 WP_000886193.1.54752 WP_000886193.1.54818 WP_000886193.1.54821 WP_000886193.1.54896 WP_000886193.1.55451 WP_000886193.1.55753 WP_000886193.1.564 WP_000886193.1.56404 WP_000886193.1.56602 WP_000886193.1.56930 WP_000886193.1.57174 WP_000886193.1.57262 WP_000886193.1.57407 WP_000886193.1.57557 WP_000886193.1.57586 WP_000886193.1.57721 WP_000886193.1.57900 WP_000886193.1.58075 WP_000886193.1.58119 WP_000886193.1.58208 WP_000886193.1.58254 WP_000886193.1.58988 WP_000886193.1.59040 WP_000886193.1.59057 WP_000886193.1.59460 WP_000886193.1.59565 WP_000886193.1.5977 WP_000886193.1.5999 WP_000886193.1.60093 WP_000886193.1.60159 WP_000886193.1.60593 WP_000886193.1.60702 WP_000886193.1.61267 WP_000886193.1.61458 WP_000886193.1.61676 WP_000886193.1.61790 WP_000886193.1.61844 WP_000886193.1.62057 WP_000886193.1.62267 WP_000886193.1.62276 WP_000886193.1.62362 WP_000886193.1.62758 WP_000886193.1.6321 WP_000886193.1.63363 WP_000886193.1.63367 WP_000886193.1.63482 WP_000886193.1.63508 WP_000886193.1.6360 WP_000886193.1.63764 WP_000886193.1.63980 WP_000886193.1.64206 WP_000886193.1.64297 WP_000886193.1.64352 WP_000886193.1.64459 WP_000886193.1.64468 WP_000886193.1.64651 WP_000886193.1.64713 WP_000886193.1.64967 WP_000886193.1.64975 WP_000886193.1.65036 WP_000886193.1.65195 WP_000886193.1.65297 WP_000886193.1.65323 WP_000886193.1.65427 WP_000886193.1.6564 WP_000886193.1.65668 WP_000886193.1.66063 WP_000886193.1.66242 WP_000886193.1.67008 WP_000886193.1.67162 WP_000886193.1.67318 WP_000886193.1.67444 WP_000886193.1.67476 WP_000886193.1.67759 WP_000886193.1.67859 WP_000886193.1.68290 WP_000886193.1.6840 WP_000886193.1.68443 WP_000886193.1.68587 WP_000886193.1.68641 WP_000886193.1.68732 WP_000886193.1.68788 WP_000886193.1.69023 WP_000886193.1.69034 WP_000886193.1.69077 WP_000886193.1.69101 WP_000886193.1.69132 WP_000886193.1.69163 WP_000886193.1.6986 WP_000886193.1.70219 WP_000886193.1.70276 WP_000886193.1.70286 WP_000886193.1.70391 WP_000886193.1.70397 WP_000886193.1.70742 WP_000886193.1.70879 WP_000886193.1.70897 WP_000886193.1.70932 WP_000886193.1.71044 WP_000886193.1.71237 WP_000886193.1.71554 WP_000886193.1.71606 WP_000886193.1.71709 WP_000886193.1.7191 WP_000886193.1.7234 WP_000886193.1.72381 WP_000886193.1.72464 WP_000886193.1.72821 WP_000886193.1.73082 WP_000886193.1.73137 WP_000886193.1.73417 WP_000886193.1.73449 WP_000886193.1.73585 WP_000886193.1.73637 WP_000886193.1.73692 WP_000886193.1.73696 WP_000886193.1.73856 WP_000886193.1.74086 WP_000886193.1.74188 WP_000886193.1.74717 WP_000886193.1.74933 WP_000886193.1.74951 WP_000886193.1.75020 WP_000886193.1.75077 WP_000886193.1.75293 WP_000886193.1.7586 WP_000886193.1.75882 WP_000886193.1.76034 WP_000886193.1.7620 WP_000886193.1.76408 WP_000886193.1.76610 WP_000886193.1.76906 WP_000886193.1.76996 WP_000886193.1.77005 WP_000886193.1.77757 WP_000886193.1.77945 WP_000886193.1.78006 WP_000886193.1.78251 WP_000886193.1.78292 WP_000886193.1.78432 WP_000886193.1.7882 WP_000886193.1.79135 WP_000886193.1.79474 WP_000886193.1.79724 WP_000886193.1.80046 WP_000886193.1.80180 WP_000886193.1.80460 WP_000886193.1.80706 WP_000886193.1.81080 WP_000886193.1.81115 WP_000886193.1.81168 WP_000886193.1.81280 WP_000886193.1.81303 WP_000886193.1.81506 WP_000886193.1.82198 WP_000886193.1.82293 WP_000886193.1.82501 WP_000886193.1.82730 WP_000886193.1.83071 WP_000886193.1.83198 WP_000886193.1.8340 WP_000886193.1.83465 WP_000886193.1.83616 WP_000886193.1.8362 WP_000886193.1.84093 WP_000886193.1.84119 WP_000886193.1.84227 WP_000886193.1.84273 WP_000886193.1.84289 WP_000886193.1.84343 WP_000886193.1.84909 WP_000886193.1.85179 WP_000886193.1.852 WP_000886193.1.85296 WP_000886193.1.85914 WP_000886193.1.85966 WP_000886193.1.8625 WP_000886193.1.86532 WP_000886193.1.86535 WP_000886193.1.86651 WP_000886193.1.86986 WP_000886193.1.87011 WP_000886193.1.87033 WP_000886193.1.87307 WP_000886193.1.87395 WP_000886193.1.87412 WP_000886193.1.87697 WP_000886193.1.87807 WP_000886193.1.87880 WP_000886193.1.87882 WP_000886193.1.88071 WP_000886193.1.88248 WP_000886193.1.88296 WP_000886193.1.88344 WP_000886193.1.887 WP_000886193.1.89132 WP_000886193.1.89248 WP_000886193.1.89303 WP_000886193.1.89336 WP_000886193.1.89477 WP_000886193.1.89574 WP_000886193.1.89608 WP_000886193.1.90068 WP_000886193.1.90074 WP_000886193.1.90214 WP_000886193.1.90411 WP_000886193.1.90530 WP_000886193.1.90664 WP_000886193.1.90666 WP_000886193.1.90867 WP_000886193.1.90941 WP_000886193.1.91002 WP_000886193.1.91223 WP_000886193.1.91285 WP_000886193.1.9136 WP_000886193.1.91673 WP_000886193.1.91731 WP_000886193.1.92184 WP_000886193.1.92219 WP_000886193.1.92320 WP_000886193.1.92547 WP_000886193.1.92590 WP_000886193.1.92647 WP_000886193.1.9295 WP_000886193.1.93080 WP_000886193.1.933 WP_000886193.1.93303 WP_000886193.1.93323 WP_000886193.1.93537 WP_000886193.1.93793 WP_000886193.1.93825 WP_000886193.1.9386 WP_000886193.1.93881 WP_000886193.1.93884 WP_000886193.1.94346 WP_000886193.1.94370 WP_000886193.1.94532 WP_000886193.1.94803 WP_000886193.1.94973 WP_000886193.1.95950 WP_000886193.1.96087 WP_000886193.1.96406 WP_000886193.1.96868 WP_000886193.1.96943 WP_000886193.1.9711 WP_000886193.1.97166 WP_000886193.1.9741 WP_000886193.1.97621 WP_000886193.1.97836 WP_000886193.1.97838 WP_000886193.1.97850 WP_000886193.1.98063 WP_000886193.1.98185 WP_000886193.1.9822 WP_000886193.1.98370 WP_000886193.1.98773 WP_000886193.1.98979 WP_000886193.1.99017 WP_000886193.1.99019 WP_000886193.1.99056 WP_000886193.1.99241 WP_000886193.1.99286 WP_000886193.1.99447 205921.SAK_0430 208435.SAG0356 211110.gbs0343 gi|22536539|ref|NP_687390.1| gi|406708877|ref|YP_006763603.1| gi|512538594|ref|YP_008084098.1| gi|25010417|ref|NP_734812.1| gi|76787984|ref|YP_329077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]