SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76788326|ref|YP_329627.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76788326|ref|YP_329627.1|
Domain Number 1 Region: 1-241
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.92e-76
Family LplA-like 0.0000000156
Further Details:      
 
Domain Number 2 Region: 242-328
Classification Level Classification E-value
Superfamily SufE/NifU 9.94e-25
Family SP1160 C-terminal domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76788326|ref|YP_329627.1|
Sequence length 329
Comment lipoate-protein ligase A [Streptococcus agalactiae A909]
Sequence
MKYIVNTSNDPAYNVALEAYAFQKLTDIDEIFILWINEPAIIIGRHQNTIQEINKEFIDK
NGIHVVRRLSGGGAVYHDLNNLNYTIISNNTQEGAFDFQTFSKPVIDTLAKLGVKAEFTG
RNDLEINGQKFAGNAQAYYKGRMMHHGCLLFDVDMSVLGQALKVSKDKIESKGIKSVRAR
VTNIVDHLSDKITVQEFSDAILAQMKEEYPEMDEYVLSDAELSEIQAMRDNQFATWDWTY
GKAPEYTIERGVRYPAGKITTYANVENSTIKSVKIFGDFFGVKPVDDIEKMLEGVRYDYK
DVLAALKTVDTSQYFSRMTPEEITKAIVD
Download sequence
Identical sequences A0A076Z318 A0A1F0CHK2 E7S4N5 F8Y027 Q8E054 Q8E5T1 S8FQW8 S8FZV3 S8H7Q8 S8HEN0 S8HQP0 S8NV12 S8NY93 S8QAP2 S9ARG5 S9BH00 S9CKU1 S9CQ32 S9L5R0
gi|406709371|ref|YP_006764097.1| 205921.SAK_1005 208435.SAG0882 211110.gbs0899 gi|22537045|ref|NP_687896.1| gi|76788326|ref|YP_329627.1| gi|410594438|ref|YP_006951165.1| NP_687896.1.71890 WP_000875296.1.100037 WP_000875296.1.100093 WP_000875296.1.100254 WP_000875296.1.100267 WP_000875296.1.10029 WP_000875296.1.100367 WP_000875296.1.100520 WP_000875296.1.100641 WP_000875296.1.100766 WP_000875296.1.100913 WP_000875296.1.101195 WP_000875296.1.101222 WP_000875296.1.101267 WP_000875296.1.101296 WP_000875296.1.101319 WP_000875296.1.101830 WP_000875296.1.101853 WP_000875296.1.101864 WP_000875296.1.101938 WP_000875296.1.101956 WP_000875296.1.102056 WP_000875296.1.10371 WP_000875296.1.10618 WP_000875296.1.1067 WP_000875296.1.10723 WP_000875296.1.11465 WP_000875296.1.1163 WP_000875296.1.11756 WP_000875296.1.12102 WP_000875296.1.12166 WP_000875296.1.12331 WP_000875296.1.1251 WP_000875296.1.12619 WP_000875296.1.12688 WP_000875296.1.12755 WP_000875296.1.12978 WP_000875296.1.13008 WP_000875296.1.13064 WP_000875296.1.13285 WP_000875296.1.13384 WP_000875296.1.13553 WP_000875296.1.13658 WP_000875296.1.13737 WP_000875296.1.1402 WP_000875296.1.14275 WP_000875296.1.1437 WP_000875296.1.14429 WP_000875296.1.14563 WP_000875296.1.14738 WP_000875296.1.14953 WP_000875296.1.14960 WP_000875296.1.15199 WP_000875296.1.15417 WP_000875296.1.15526 WP_000875296.1.15760 WP_000875296.1.16134 WP_000875296.1.16165 WP_000875296.1.16335 WP_000875296.1.16342 WP_000875296.1.16535 WP_000875296.1.16595 WP_000875296.1.16706 WP_000875296.1.1681 WP_000875296.1.1696 WP_000875296.1.17056 WP_000875296.1.17339 WP_000875296.1.17489 WP_000875296.1.1760 WP_000875296.1.17707 WP_000875296.1.17709 WP_000875296.1.1775 WP_000875296.1.17815 WP_000875296.1.18047 WP_000875296.1.18450 WP_000875296.1.18747 WP_000875296.1.18829 WP_000875296.1.18841 WP_000875296.1.18933 WP_000875296.1.19604 WP_000875296.1.19892 WP_000875296.1.19950 WP_000875296.1.20188 WP_000875296.1.20258 WP_000875296.1.20435 WP_000875296.1.20511 WP_000875296.1.20791 WP_000875296.1.20847 WP_000875296.1.21522 WP_000875296.1.21525 WP_000875296.1.21722 WP_000875296.1.21779 WP_000875296.1.22004 WP_000875296.1.222 WP_000875296.1.22247 WP_000875296.1.22801 WP_000875296.1.23126 WP_000875296.1.23380 WP_000875296.1.23384 WP_000875296.1.24441 WP_000875296.1.24475 WP_000875296.1.24845 WP_000875296.1.25182 WP_000875296.1.25647 WP_000875296.1.25781 WP_000875296.1.25949 WP_000875296.1.25998 WP_000875296.1.26029 WP_000875296.1.26046 WP_000875296.1.26056 WP_000875296.1.26258 WP_000875296.1.26300 WP_000875296.1.26357 WP_000875296.1.26386 WP_000875296.1.2651 WP_000875296.1.26786 WP_000875296.1.26791 WP_000875296.1.27024 WP_000875296.1.27318 WP_000875296.1.27583 WP_000875296.1.27880 WP_000875296.1.27958 WP_000875296.1.28021 WP_000875296.1.28342 WP_000875296.1.28630 WP_000875296.1.28738 WP_000875296.1.29020 WP_000875296.1.29163 WP_000875296.1.29238 WP_000875296.1.29352 WP_000875296.1.29532 WP_000875296.1.29719 WP_000875296.1.29771 WP_000875296.1.30062 WP_000875296.1.30200 WP_000875296.1.30252 WP_000875296.1.3028 WP_000875296.1.30321 WP_000875296.1.30388 WP_000875296.1.30603 WP_000875296.1.30703 WP_000875296.1.30710 WP_000875296.1.3074 WP_000875296.1.30831 WP_000875296.1.30974 WP_000875296.1.31109 WP_000875296.1.3112 WP_000875296.1.31250 WP_000875296.1.31888 WP_000875296.1.31894 WP_000875296.1.31904 WP_000875296.1.32053 WP_000875296.1.32520 WP_000875296.1.32603 WP_000875296.1.32728 WP_000875296.1.32745 WP_000875296.1.32818 WP_000875296.1.33105 WP_000875296.1.34276 WP_000875296.1.34467 WP_000875296.1.34475 WP_000875296.1.34896 WP_000875296.1.34906 WP_000875296.1.35216 WP_000875296.1.35428 WP_000875296.1.3543 WP_000875296.1.35443 WP_000875296.1.35451 WP_000875296.1.35908 WP_000875296.1.36095 WP_000875296.1.36202 WP_000875296.1.36258 WP_000875296.1.36408 WP_000875296.1.36594 WP_000875296.1.36710 WP_000875296.1.36878 WP_000875296.1.36977 WP_000875296.1.37018 WP_000875296.1.37098 WP_000875296.1.37124 WP_000875296.1.37523 WP_000875296.1.37547 WP_000875296.1.37570 WP_000875296.1.3814 WP_000875296.1.38578 WP_000875296.1.3880 WP_000875296.1.38842 WP_000875296.1.38910 WP_000875296.1.39284 WP_000875296.1.3930 WP_000875296.1.3937 WP_000875296.1.39386 WP_000875296.1.3963 WP_000875296.1.39656 WP_000875296.1.39673 WP_000875296.1.40015 WP_000875296.1.40359 WP_000875296.1.40650 WP_000875296.1.40774 WP_000875296.1.40812 WP_000875296.1.41269 WP_000875296.1.41329 WP_000875296.1.41399 WP_000875296.1.41646 WP_000875296.1.41663 WP_000875296.1.41785 WP_000875296.1.42144 WP_000875296.1.4215 WP_000875296.1.42225 WP_000875296.1.42271 WP_000875296.1.42540 WP_000875296.1.42844 WP_000875296.1.43138 WP_000875296.1.4323 WP_000875296.1.44371 WP_000875296.1.44374 WP_000875296.1.44712 WP_000875296.1.44727 WP_000875296.1.44746 WP_000875296.1.44777 WP_000875296.1.44957 WP_000875296.1.45 WP_000875296.1.45103 WP_000875296.1.45150 WP_000875296.1.45180 WP_000875296.1.45790 WP_000875296.1.45976 WP_000875296.1.46043 WP_000875296.1.46116 WP_000875296.1.47485 WP_000875296.1.47497 WP_000875296.1.47584 WP_000875296.1.47608 WP_000875296.1.48052 WP_000875296.1.48239 WP_000875296.1.48416 WP_000875296.1.48518 WP_000875296.1.48557 WP_000875296.1.48911 WP_000875296.1.49082 WP_000875296.1.49278 WP_000875296.1.49371 WP_000875296.1.49421 WP_000875296.1.49423 WP_000875296.1.49508 WP_000875296.1.49888 WP_000875296.1.49965 WP_000875296.1.50082 WP_000875296.1.50186 WP_000875296.1.50326 WP_000875296.1.5055 WP_000875296.1.50552 WP_000875296.1.50776 WP_000875296.1.50874 WP_000875296.1.51102 WP_000875296.1.51114 WP_000875296.1.51125 WP_000875296.1.5137 WP_000875296.1.51570 WP_000875296.1.51780 WP_000875296.1.52139 WP_000875296.1.52273 WP_000875296.1.52470 WP_000875296.1.52729 WP_000875296.1.52826 WP_000875296.1.52916 WP_000875296.1.53087 WP_000875296.1.53549 WP_000875296.1.54107 WP_000875296.1.54156 WP_000875296.1.54228 WP_000875296.1.54416 WP_000875296.1.54423 WP_000875296.1.54487 WP_000875296.1.5451 WP_000875296.1.54629 WP_000875296.1.54752 WP_000875296.1.54757 WP_000875296.1.54818 WP_000875296.1.54821 WP_000875296.1.54844 WP_000875296.1.54896 WP_000875296.1.54978 WP_000875296.1.55655 WP_000875296.1.55673 WP_000875296.1.55753 WP_000875296.1.55775 WP_000875296.1.55921 WP_000875296.1.56011 WP_000875296.1.56043 WP_000875296.1.56192 WP_000875296.1.564 WP_000875296.1.56404 WP_000875296.1.56602 WP_000875296.1.56930 WP_000875296.1.57174 WP_000875296.1.57262 WP_000875296.1.57336 WP_000875296.1.57407 WP_000875296.1.57557 WP_000875296.1.57586 WP_000875296.1.57721 WP_000875296.1.57900 WP_000875296.1.58075 WP_000875296.1.58119 WP_000875296.1.58208 WP_000875296.1.58254 WP_000875296.1.58255 WP_000875296.1.58297 WP_000875296.1.58520 WP_000875296.1.58988 WP_000875296.1.59040 WP_000875296.1.59057 WP_000875296.1.59460 WP_000875296.1.59565 WP_000875296.1.5977 WP_000875296.1.59783 WP_000875296.1.5999 WP_000875296.1.60093 WP_000875296.1.60593 WP_000875296.1.60702 WP_000875296.1.61176 WP_000875296.1.61267 WP_000875296.1.6131 WP_000875296.1.61458 WP_000875296.1.61554 WP_000875296.1.61676 WP_000875296.1.61790 WP_000875296.1.61844 WP_000875296.1.62267 WP_000875296.1.62276 WP_000875296.1.62362 WP_000875296.1.62758 WP_000875296.1.6321 WP_000875296.1.63345 WP_000875296.1.63363 WP_000875296.1.63367 WP_000875296.1.63482 WP_000875296.1.63508 WP_000875296.1.6360 WP_000875296.1.63764 WP_000875296.1.63980 WP_000875296.1.64182 WP_000875296.1.64256 WP_000875296.1.64352 WP_000875296.1.64459 WP_000875296.1.64468 WP_000875296.1.64651 WP_000875296.1.64713 WP_000875296.1.64967 WP_000875296.1.65036 WP_000875296.1.65195 WP_000875296.1.6526 WP_000875296.1.65297 WP_000875296.1.65323 WP_000875296.1.65427 WP_000875296.1.6564 WP_000875296.1.65668 WP_000875296.1.66063 WP_000875296.1.66242 WP_000875296.1.67002 WP_000875296.1.67008 WP_000875296.1.67162 WP_000875296.1.67277 WP_000875296.1.67318 WP_000875296.1.67444 WP_000875296.1.67476 WP_000875296.1.67759 WP_000875296.1.67859 WP_000875296.1.68290 WP_000875296.1.6840 WP_000875296.1.68413 WP_000875296.1.68443 WP_000875296.1.68587 WP_000875296.1.68641 WP_000875296.1.68732 WP_000875296.1.68788 WP_000875296.1.68827 WP_000875296.1.68890 WP_000875296.1.68905 WP_000875296.1.69023 WP_000875296.1.69034 WP_000875296.1.69077 WP_000875296.1.69101 WP_000875296.1.69132 WP_000875296.1.69163 WP_000875296.1.69214 WP_000875296.1.6986 WP_000875296.1.7017 WP_000875296.1.70219 WP_000875296.1.70276 WP_000875296.1.70286 WP_000875296.1.70391 WP_000875296.1.70397 WP_000875296.1.70562 WP_000875296.1.70742 WP_000875296.1.70879 WP_000875296.1.70897 WP_000875296.1.70932 WP_000875296.1.71044 WP_000875296.1.71554 WP_000875296.1.71606 WP_000875296.1.71709 WP_000875296.1.7191 WP_000875296.1.72284 WP_000875296.1.7234 WP_000875296.1.72464 WP_000875296.1.72821 WP_000875296.1.73082 WP_000875296.1.73137 WP_000875296.1.73417 WP_000875296.1.73439 WP_000875296.1.73449 WP_000875296.1.73585 WP_000875296.1.73625 WP_000875296.1.73637 WP_000875296.1.73692 WP_000875296.1.73696 WP_000875296.1.73856 WP_000875296.1.74086 WP_000875296.1.74188 WP_000875296.1.74375 WP_000875296.1.74717 WP_000875296.1.74933 WP_000875296.1.74951 WP_000875296.1.75020 WP_000875296.1.75077 WP_000875296.1.75293 WP_000875296.1.7530 WP_000875296.1.7586 WP_000875296.1.75882 WP_000875296.1.76222 WP_000875296.1.76334 WP_000875296.1.76408 WP_000875296.1.76610 WP_000875296.1.76747 WP_000875296.1.76906 WP_000875296.1.76996 WP_000875296.1.77005 WP_000875296.1.77493 WP_000875296.1.77757 WP_000875296.1.78006 WP_000875296.1.78251 WP_000875296.1.78292 WP_000875296.1.78432 WP_000875296.1.78464 WP_000875296.1.78552 WP_000875296.1.7882 WP_000875296.1.78994 WP_000875296.1.79135 WP_000875296.1.79474 WP_000875296.1.79724 WP_000875296.1.80046 WP_000875296.1.80180 WP_000875296.1.80438 WP_000875296.1.80460 WP_000875296.1.80706 WP_000875296.1.80895 WP_000875296.1.81080 WP_000875296.1.81115 WP_000875296.1.81168 WP_000875296.1.81280 WP_000875296.1.81303 WP_000875296.1.81506 WP_000875296.1.82198 WP_000875296.1.82293 WP_000875296.1.82501 WP_000875296.1.82730 WP_000875296.1.83071 WP_000875296.1.83198 WP_000875296.1.8340 WP_000875296.1.83429 WP_000875296.1.83465 WP_000875296.1.83616 WP_000875296.1.83723 WP_000875296.1.83944 WP_000875296.1.84093 WP_000875296.1.84119 WP_000875296.1.84227 WP_000875296.1.84273 WP_000875296.1.84343 WP_000875296.1.84909 WP_000875296.1.85015 WP_000875296.1.85179 WP_000875296.1.852 WP_000875296.1.8568 WP_000875296.1.85914 WP_000875296.1.85966 WP_000875296.1.8625 WP_000875296.1.86400 WP_000875296.1.86511 WP_000875296.1.86532 WP_000875296.1.86651 WP_000875296.1.86986 WP_000875296.1.87033 WP_000875296.1.87307 WP_000875296.1.87395 WP_000875296.1.87412 WP_000875296.1.87807 WP_000875296.1.87810 WP_000875296.1.87880 WP_000875296.1.87882 WP_000875296.1.88071 WP_000875296.1.88248 WP_000875296.1.88296 WP_000875296.1.88344 WP_000875296.1.88357 WP_000875296.1.887 WP_000875296.1.88701 WP_000875296.1.88855 WP_000875296.1.89132 WP_000875296.1.89248 WP_000875296.1.89303 WP_000875296.1.89336 WP_000875296.1.89477 WP_000875296.1.89574 WP_000875296.1.89608 WP_000875296.1.90019 WP_000875296.1.90068 WP_000875296.1.90074 WP_000875296.1.90136 WP_000875296.1.90214 WP_000875296.1.90411 WP_000875296.1.90530 WP_000875296.1.90664 WP_000875296.1.90666 WP_000875296.1.90941 WP_000875296.1.91002 WP_000875296.1.91223 WP_000875296.1.9125 WP_000875296.1.91270 WP_000875296.1.91285 WP_000875296.1.9136 WP_000875296.1.91673 WP_000875296.1.92184 WP_000875296.1.92320 WP_000875296.1.92547 WP_000875296.1.92647 WP_000875296.1.92762 WP_000875296.1.9295 WP_000875296.1.93080 WP_000875296.1.933 WP_000875296.1.93303 WP_000875296.1.93323 WP_000875296.1.93358 WP_000875296.1.93537 WP_000875296.1.93607 WP_000875296.1.93793 WP_000875296.1.93825 WP_000875296.1.9386 WP_000875296.1.93881 WP_000875296.1.94310 WP_000875296.1.94346 WP_000875296.1.94370 WP_000875296.1.94532 WP_000875296.1.94803 WP_000875296.1.94973 WP_000875296.1.95950 WP_000875296.1.95993 WP_000875296.1.96087 WP_000875296.1.96116 WP_000875296.1.96137 WP_000875296.1.96475 WP_000875296.1.96868 WP_000875296.1.96943 WP_000875296.1.96986 WP_000875296.1.9711 WP_000875296.1.97166 WP_000875296.1.97630 WP_000875296.1.97836 WP_000875296.1.97838 WP_000875296.1.97850 WP_000875296.1.98063 WP_000875296.1.98185 WP_000875296.1.9822 WP_000875296.1.98346 WP_000875296.1.98370 WP_000875296.1.98638 WP_000875296.1.98766 WP_000875296.1.98832 WP_000875296.1.98979 WP_000875296.1.99019 WP_000875296.1.99056 WP_000875296.1.99149 WP_000875296.1.99241 WP_000875296.1.99286 WP_000875296.1.99447 gi|25010953|ref|NP_735348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]