SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76788350|ref|YP_329959.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76788350|ref|YP_329959.1|
Domain Number - Region: 41-107
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00732
Family DNA-binding N-terminal domain of transcription activators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76788350|ref|YP_329959.1|
Sequence length 149
Comment hypothetical protein SAK_1349 [Streptococcus agalactiae A909]
Sequence
MNKNQYPKWEELPELDLYLDQVLLYVNQLINPKTITNDKLLTASMINNYVKHNYISKPIK
KKYNRRQVARLIVITAFKQVFAIQEISQTLEILTADNHSEEAYNGFAACMNKEEVHDLPP
VVISACQTLNLYQETQKLVLELGGKNKNA
Download sequence
Identical sequences A0A076Z1P5 Q8E4L3
gi|512539542|ref|YP_008085046.1| gi|406709711|ref|YP_006764437.1| gi|76788350|ref|YP_329959.1| 205921.SAK_1349 211110.gbs1388 gi|25011430|ref|NP_735825.1| WP_001039193.1.100093 WP_001039193.1.100267 WP_001039193.1.10029 WP_001039193.1.100367 WP_001039193.1.100520 WP_001039193.1.100641 WP_001039193.1.100766 WP_001039193.1.100913 WP_001039193.1.101195 WP_001039193.1.101267 WP_001039193.1.101296 WP_001039193.1.101830 WP_001039193.1.101853 WP_001039193.1.101864 WP_001039193.1.102056 WP_001039193.1.10371 WP_001039193.1.10723 WP_001039193.1.10924 WP_001039193.1.11465 WP_001039193.1.1163 WP_001039193.1.12102 WP_001039193.1.12166 WP_001039193.1.12331 WP_001039193.1.1251 WP_001039193.1.12619 WP_001039193.1.12688 WP_001039193.1.12755 WP_001039193.1.12978 WP_001039193.1.13658 WP_001039193.1.14275 WP_001039193.1.14324 WP_001039193.1.1437 WP_001039193.1.14563 WP_001039193.1.14738 WP_001039193.1.15526 WP_001039193.1.15556 WP_001039193.1.15760 WP_001039193.1.16134 WP_001039193.1.16165 WP_001039193.1.16342 WP_001039193.1.16535 WP_001039193.1.16595 WP_001039193.1.1681 WP_001039193.1.17056 WP_001039193.1.17339 WP_001039193.1.17489 WP_001039193.1.1760 WP_001039193.1.17707 WP_001039193.1.1775 WP_001039193.1.17815 WP_001039193.1.18425 WP_001039193.1.18450 WP_001039193.1.18841 WP_001039193.1.18933 WP_001039193.1.19604 WP_001039193.1.19892 WP_001039193.1.20123 WP_001039193.1.20188 WP_001039193.1.20326 WP_001039193.1.20435 WP_001039193.1.20511 WP_001039193.1.20847 WP_001039193.1.21525 WP_001039193.1.21722 WP_001039193.1.21779 WP_001039193.1.22004 WP_001039193.1.22139 WP_001039193.1.222 WP_001039193.1.23126 WP_001039193.1.23380 WP_001039193.1.23384 WP_001039193.1.24475 WP_001039193.1.25182 WP_001039193.1.25647 WP_001039193.1.25781 WP_001039193.1.25949 WP_001039193.1.26046 WP_001039193.1.26056 WP_001039193.1.2651 WP_001039193.1.26786 WP_001039193.1.26791 WP_001039193.1.26827 WP_001039193.1.27024 WP_001039193.1.27318 WP_001039193.1.2754 WP_001039193.1.27583 WP_001039193.1.27880 WP_001039193.1.27958 WP_001039193.1.28021 WP_001039193.1.28630 WP_001039193.1.29238 WP_001039193.1.29352 WP_001039193.1.29719 WP_001039193.1.29771 WP_001039193.1.29888 WP_001039193.1.30062 WP_001039193.1.30252 WP_001039193.1.3028 WP_001039193.1.30321 WP_001039193.1.30388 WP_001039193.1.30703 WP_001039193.1.30710 WP_001039193.1.3074 WP_001039193.1.31109 WP_001039193.1.3112 WP_001039193.1.31250 WP_001039193.1.3166 WP_001039193.1.31888 WP_001039193.1.31894 WP_001039193.1.31904 WP_001039193.1.32520 WP_001039193.1.32728 WP_001039193.1.32818 WP_001039193.1.33105 WP_001039193.1.33723 WP_001039193.1.34227 WP_001039193.1.34276 WP_001039193.1.34467 WP_001039193.1.34475 WP_001039193.1.34896 WP_001039193.1.34906 WP_001039193.1.35428 WP_001039193.1.3543 WP_001039193.1.35451 WP_001039193.1.36095 WP_001039193.1.36202 WP_001039193.1.36258 WP_001039193.1.36408 WP_001039193.1.36594 WP_001039193.1.36710 WP_001039193.1.36878 WP_001039193.1.36977 WP_001039193.1.37018 WP_001039193.1.37098 WP_001039193.1.37547 WP_001039193.1.3814 WP_001039193.1.38578 WP_001039193.1.38699 WP_001039193.1.3880 WP_001039193.1.38842 WP_001039193.1.39284 WP_001039193.1.39386 WP_001039193.1.3963 WP_001039193.1.39656 WP_001039193.1.39673 WP_001039193.1.40015 WP_001039193.1.40203 WP_001039193.1.40359 WP_001039193.1.40650 WP_001039193.1.40774 WP_001039193.1.41329 WP_001039193.1.41399 WP_001039193.1.41663 WP_001039193.1.41785 WP_001039193.1.42271 WP_001039193.1.42540 WP_001039193.1.42844 WP_001039193.1.43138 WP_001039193.1.43199 WP_001039193.1.44371 WP_001039193.1.44712 WP_001039193.1.44727 WP_001039193.1.44746 WP_001039193.1.44777 WP_001039193.1.45 WP_001039193.1.45150 WP_001039193.1.45180 WP_001039193.1.45540 WP_001039193.1.45896 WP_001039193.1.45976 WP_001039193.1.46043 WP_001039193.1.46116 WP_001039193.1.46992 WP_001039193.1.47485 WP_001039193.1.47497 WP_001039193.1.47584 WP_001039193.1.47608 WP_001039193.1.48052 WP_001039193.1.48239 WP_001039193.1.48416 WP_001039193.1.48518 WP_001039193.1.48557 WP_001039193.1.49371 WP_001039193.1.50186 WP_001039193.1.50326 WP_001039193.1.5055 WP_001039193.1.50552 WP_001039193.1.50776 WP_001039193.1.50874 WP_001039193.1.51102 WP_001039193.1.51125 WP_001039193.1.51780 WP_001039193.1.52273 WP_001039193.1.52470 WP_001039193.1.52634 WP_001039193.1.52826 WP_001039193.1.52981 WP_001039193.1.53549 WP_001039193.1.54156 WP_001039193.1.54416 WP_001039193.1.54423 WP_001039193.1.54487 WP_001039193.1.54757 WP_001039193.1.54818 WP_001039193.1.54844 WP_001039193.1.54896 WP_001039193.1.54978 WP_001039193.1.55451 WP_001039193.1.55753 WP_001039193.1.55775 WP_001039193.1.55921 WP_001039193.1.56011 WP_001039193.1.56192 WP_001039193.1.564 WP_001039193.1.56404 WP_001039193.1.57174 WP_001039193.1.57336 WP_001039193.1.57557 WP_001039193.1.57586 WP_001039193.1.57721 WP_001039193.1.57900 WP_001039193.1.58075 WP_001039193.1.58208 WP_001039193.1.58255 WP_001039193.1.58297 WP_001039193.1.58520 WP_001039193.1.58988 WP_001039193.1.59565 WP_001039193.1.5977 WP_001039193.1.59783 WP_001039193.1.60159 WP_001039193.1.60593 WP_001039193.1.61176 WP_001039193.1.61267 WP_001039193.1.6131 WP_001039193.1.61458 WP_001039193.1.61676 WP_001039193.1.61790 WP_001039193.1.62057 WP_001039193.1.62758 WP_001039193.1.6321 WP_001039193.1.63345 WP_001039193.1.63363 WP_001039193.1.63482 WP_001039193.1.63508 WP_001039193.1.6360 WP_001039193.1.63980 WP_001039193.1.64206 WP_001039193.1.64256 WP_001039193.1.64297 WP_001039193.1.64459 WP_001039193.1.64468 WP_001039193.1.64651 WP_001039193.1.64713 WP_001039193.1.64975 WP_001039193.1.65036 WP_001039193.1.65297 WP_001039193.1.65323 WP_001039193.1.66242 WP_001039193.1.67002 WP_001039193.1.67008 WP_001039193.1.67162 WP_001039193.1.67277 WP_001039193.1.67318 WP_001039193.1.67444 WP_001039193.1.67476 WP_001039193.1.67759 WP_001039193.1.68290 WP_001039193.1.6840 WP_001039193.1.68587 WP_001039193.1.68641 WP_001039193.1.68732 WP_001039193.1.68788 WP_001039193.1.68905 WP_001039193.1.69023 WP_001039193.1.69077 WP_001039193.1.69101 WP_001039193.1.69132 WP_001039193.1.69214 WP_001039193.1.7017 WP_001039193.1.70219 WP_001039193.1.70276 WP_001039193.1.70286 WP_001039193.1.70397 WP_001039193.1.70742 WP_001039193.1.70879 WP_001039193.1.70897 WP_001039193.1.71044 WP_001039193.1.71237 WP_001039193.1.71554 WP_001039193.1.7191 WP_001039193.1.72284 WP_001039193.1.7234 WP_001039193.1.72381 WP_001039193.1.73082 WP_001039193.1.73137 WP_001039193.1.73417 WP_001039193.1.73625 WP_001039193.1.73637 WP_001039193.1.73696 WP_001039193.1.74086 WP_001039193.1.74188 WP_001039193.1.74375 WP_001039193.1.74951 WP_001039193.1.75077 WP_001039193.1.75293 WP_001039193.1.7530 WP_001039193.1.7586 WP_001039193.1.76034 WP_001039193.1.7620 WP_001039193.1.76222 WP_001039193.1.76408 WP_001039193.1.76610 WP_001039193.1.76747 WP_001039193.1.76906 WP_001039193.1.76996 WP_001039193.1.77005 WP_001039193.1.77493 WP_001039193.1.77945 WP_001039193.1.78251 WP_001039193.1.78432 WP_001039193.1.78464 WP_001039193.1.78552 WP_001039193.1.78994 WP_001039193.1.79135 WP_001039193.1.79724 WP_001039193.1.80180 WP_001039193.1.80706 WP_001039193.1.80895 WP_001039193.1.81115 WP_001039193.1.81168 WP_001039193.1.81280 WP_001039193.1.81303 WP_001039193.1.81506 WP_001039193.1.82501 WP_001039193.1.82730 WP_001039193.1.83429 WP_001039193.1.83616 WP_001039193.1.8362 WP_001039193.1.83723 WP_001039193.1.84119 WP_001039193.1.84227 WP_001039193.1.84289 WP_001039193.1.84343 WP_001039193.1.84909 WP_001039193.1.85015 WP_001039193.1.85179 WP_001039193.1.852 WP_001039193.1.85296 WP_001039193.1.8568 WP_001039193.1.85914 WP_001039193.1.86400 WP_001039193.1.86511 WP_001039193.1.86532 WP_001039193.1.86535 WP_001039193.1.86986 WP_001039193.1.87011 WP_001039193.1.87033 WP_001039193.1.87307 WP_001039193.1.87395 WP_001039193.1.87412 WP_001039193.1.87697 WP_001039193.1.87807 WP_001039193.1.87810 WP_001039193.1.87880 WP_001039193.1.87882 WP_001039193.1.88071 WP_001039193.1.88248 WP_001039193.1.88296 WP_001039193.1.88344 WP_001039193.1.88357 WP_001039193.1.887 WP_001039193.1.89248 WP_001039193.1.89477 WP_001039193.1.89574 WP_001039193.1.89608 WP_001039193.1.90136 WP_001039193.1.90214 WP_001039193.1.90411 WP_001039193.1.90530 WP_001039193.1.90664 WP_001039193.1.90666 WP_001039193.1.90867 WP_001039193.1.90941 WP_001039193.1.91002 WP_001039193.1.91223 WP_001039193.1.9125 WP_001039193.1.91285 WP_001039193.1.91673 WP_001039193.1.91731 WP_001039193.1.92219 WP_001039193.1.92320 WP_001039193.1.92590 WP_001039193.1.92647 WP_001039193.1.92762 WP_001039193.1.933 WP_001039193.1.93303 WP_001039193.1.93323 WP_001039193.1.93358 WP_001039193.1.93537 WP_001039193.1.9386 WP_001039193.1.93884 WP_001039193.1.94310 WP_001039193.1.94370 WP_001039193.1.94532 WP_001039193.1.94803 WP_001039193.1.95950 WP_001039193.1.95993 WP_001039193.1.96087 WP_001039193.1.96406 WP_001039193.1.96475 WP_001039193.1.96868 WP_001039193.1.96943 WP_001039193.1.97166 WP_001039193.1.9741 WP_001039193.1.97621 WP_001039193.1.97630 WP_001039193.1.97836 WP_001039193.1.97838 WP_001039193.1.97850 WP_001039193.1.98063 WP_001039193.1.9822 WP_001039193.1.98773 WP_001039193.1.98979 WP_001039193.1.99017 WP_001039193.1.99056 WP_001039193.1.99149 WP_001039193.1.99241 WP_001039193.1.99286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]