SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76788373|ref|YP_330383.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76788373|ref|YP_330383.1|
Domain Number 1 Region: 13-88
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.4e-19
Family DNA-binding N-terminal domain of transcription activators 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76788373|ref|YP_330383.1|
Sequence length 123
Comment GlnR family transcriptional regulator [Streptococcus agalactiae A909]
Sequence
MKERELRRTMAVFPIGAVMKLTDLTARQIRYYEDQGLITPERTEGNRRMFSLNDMDRLLE
IKDFISDGLHISDIKNEYMQRQHKSKEKQKSLSDAEVRRLLQDELRNQGRFSSPSQHIGN
MHL
Download sequence
Identical sequences A0A1F0CE70 A0A1J7WBD9 E7S2C7 F8Y2T9 H6W0Y3 Q8DXT2 S8FJ02 S8HN65 S8NSU5 S8NYJ6 S8PBR9 S9B5E5 S9C7E9 S9CDM4 S9D6B2 S9L166
gi|512699151|ref|YP_008118436.1| gi|406710157|ref|YP_006764883.1| gi|22537903|ref|NP_688754.1| NP_688754.1.71890 WP_000664338.1.100058 WP_000664338.1.100254 WP_000664338.1.10029 WP_000664338.1.100355 WP_000664338.1.100367 WP_000664338.1.100766 WP_000664338.1.100991 WP_000664338.1.101208 WP_000664338.1.101222 WP_000664338.1.101267 WP_000664338.1.101283 WP_000664338.1.101296 WP_000664338.1.101328 WP_000664338.1.101830 WP_000664338.1.101853 WP_000664338.1.101864 WP_000664338.1.101938 WP_000664338.1.101956 WP_000664338.1.10297 WP_000664338.1.10371 WP_000664338.1.10618 WP_000664338.1.10620 WP_000664338.1.1067 WP_000664338.1.10676 WP_000664338.1.10723 WP_000664338.1.10924 WP_000664338.1.11248 WP_000664338.1.11343 WP_000664338.1.11446 WP_000664338.1.11465 WP_000664338.1.11756 WP_000664338.1.11774 WP_000664338.1.11941 WP_000664338.1.12072 WP_000664338.1.12166 WP_000664338.1.12249 WP_000664338.1.12363 WP_000664338.1.1251 WP_000664338.1.12619 WP_000664338.1.12688 WP_000664338.1.12755 WP_000664338.1.1293 WP_000664338.1.12978 WP_000664338.1.13008 WP_000664338.1.13064 WP_000664338.1.13167 WP_000664338.1.13285 WP_000664338.1.13384 WP_000664338.1.13493 WP_000664338.1.13553 WP_000664338.1.13737 WP_000664338.1.13885 WP_000664338.1.1402 WP_000664338.1.14140 WP_000664338.1.14275 WP_000664338.1.14324 WP_000664338.1.14368 WP_000664338.1.1437 WP_000664338.1.14429 WP_000664338.1.14563 WP_000664338.1.14738 WP_000664338.1.14953 WP_000664338.1.14960 WP_000664338.1.15385 WP_000664338.1.15417 WP_000664338.1.15526 WP_000664338.1.15556 WP_000664338.1.16134 WP_000664338.1.16165 WP_000664338.1.1633 WP_000664338.1.16335 WP_000664338.1.16342 WP_000664338.1.16535 WP_000664338.1.16580 WP_000664338.1.16595 WP_000664338.1.16706 WP_000664338.1.16976 WP_000664338.1.17243 WP_000664338.1.17339 WP_000664338.1.17380 WP_000664338.1.17489 WP_000664338.1.17506 WP_000664338.1.1760 WP_000664338.1.17709 WP_000664338.1.1775 WP_000664338.1.18003 WP_000664338.1.18047 WP_000664338.1.18263 WP_000664338.1.18362 WP_000664338.1.18425 WP_000664338.1.18450 WP_000664338.1.18747 WP_000664338.1.1882 WP_000664338.1.18829 WP_000664338.1.18841 WP_000664338.1.18933 WP_000664338.1.19073 WP_000664338.1.19086 WP_000664338.1.19892 WP_000664338.1.19950 WP_000664338.1.20123 WP_000664338.1.20188 WP_000664338.1.20258 WP_000664338.1.20326 WP_000664338.1.20458 WP_000664338.1.20717 WP_000664338.1.20726 WP_000664338.1.20791 WP_000664338.1.20847 WP_000664338.1.21061 WP_000664338.1.21087 WP_000664338.1.21280 WP_000664338.1.21522 WP_000664338.1.21525 WP_000664338.1.21669 WP_000664338.1.21722 WP_000664338.1.21860 WP_000664338.1.2195 WP_000664338.1.22004 WP_000664338.1.22076 WP_000664338.1.22087 WP_000664338.1.22139 WP_000664338.1.22247 WP_000664338.1.22552 WP_000664338.1.22749 WP_000664338.1.22801 WP_000664338.1.23380 WP_000664338.1.23384 WP_000664338.1.23508 WP_000664338.1.24296 WP_000664338.1.24441 WP_000664338.1.24475 WP_000664338.1.24559 WP_000664338.1.24827 WP_000664338.1.24845 WP_000664338.1.25002 WP_000664338.1.2509 WP_000664338.1.25303 WP_000664338.1.2555 WP_000664338.1.25670 WP_000664338.1.25781 WP_000664338.1.25973 WP_000664338.1.25985 WP_000664338.1.25998 WP_000664338.1.26029 WP_000664338.1.26056 WP_000664338.1.26153 WP_000664338.1.26174 WP_000664338.1.26258 WP_000664338.1.26312 WP_000664338.1.26357 WP_000664338.1.26386 WP_000664338.1.2651 WP_000664338.1.26791 WP_000664338.1.26827 WP_000664338.1.27024 WP_000664338.1.27184 WP_000664338.1.27325 WP_000664338.1.2754 WP_000664338.1.27583 WP_000664338.1.27751 WP_000664338.1.2781 WP_000664338.1.27880 WP_000664338.1.27958 WP_000664338.1.28021 WP_000664338.1.28197 WP_000664338.1.28342 WP_000664338.1.2844 WP_000664338.1.28613 WP_000664338.1.28624 WP_000664338.1.28991 WP_000664338.1.29020 WP_000664338.1.29163 WP_000664338.1.29238 WP_000664338.1.29352 WP_000664338.1.29410 WP_000664338.1.29470 WP_000664338.1.29532 WP_000664338.1.29719 WP_000664338.1.29888 WP_000664338.1.30062 WP_000664338.1.30182 WP_000664338.1.30200 WP_000664338.1.30252 WP_000664338.1.30310 WP_000664338.1.30450 WP_000664338.1.3052 WP_000664338.1.30603 WP_000664338.1.30703 WP_000664338.1.30710 WP_000664338.1.3074 WP_000664338.1.30831 WP_000664338.1.30974 WP_000664338.1.3112 WP_000664338.1.3166 WP_000664338.1.31888 WP_000664338.1.31896 WP_000664338.1.32511 WP_000664338.1.32520 WP_000664338.1.32603 WP_000664338.1.32728 WP_000664338.1.32745 WP_000664338.1.32818 WP_000664338.1.33723 WP_000664338.1.34227 WP_000664338.1.34276 WP_000664338.1.34467 WP_000664338.1.34475 WP_000664338.1.34828 WP_000664338.1.34896 WP_000664338.1.34906 WP_000664338.1.35119 WP_000664338.1.35216 WP_000664338.1.35399 WP_000664338.1.35428 WP_000664338.1.35443 WP_000664338.1.35621 WP_000664338.1.35908 WP_000664338.1.35937 WP_000664338.1.36095 WP_000664338.1.36403 WP_000664338.1.36408 WP_000664338.1.3658 WP_000664338.1.36726 WP_000664338.1.36776 WP_000664338.1.36800 WP_000664338.1.36878 WP_000664338.1.3691 WP_000664338.1.36977 WP_000664338.1.37018 WP_000664338.1.37098 WP_000664338.1.37523 WP_000664338.1.37570 WP_000664338.1.37692 WP_000664338.1.38237 WP_000664338.1.3845 WP_000664338.1.38456 WP_000664338.1.38578 WP_000664338.1.38699 WP_000664338.1.3880 WP_000664338.1.38842 WP_000664338.1.38910 WP_000664338.1.3927 WP_000664338.1.3930 WP_000664338.1.3937 WP_000664338.1.39381 WP_000664338.1.39386 WP_000664338.1.39495 WP_000664338.1.3963 WP_000664338.1.40015 WP_000664338.1.40055 WP_000664338.1.40203 WP_000664338.1.40241 WP_000664338.1.40359 WP_000664338.1.40538 WP_000664338.1.40694 WP_000664338.1.40765 WP_000664338.1.40812 WP_000664338.1.41269 WP_000664338.1.41338 WP_000664338.1.41399 WP_000664338.1.41646 WP_000664338.1.41663 WP_000664338.1.41785 WP_000664338.1.41865 WP_000664338.1.4215 WP_000664338.1.42225 WP_000664338.1.42477 WP_000664338.1.42686 WP_000664338.1.42844 WP_000664338.1.43199 WP_000664338.1.4323 WP_000664338.1.43571 WP_000664338.1.43981 WP_000664338.1.44371 WP_000664338.1.44374 WP_000664338.1.4446 WP_000664338.1.44614 WP_000664338.1.44712 WP_000664338.1.44727 WP_000664338.1.44746 WP_000664338.1.44957 WP_000664338.1.45 WP_000664338.1.45058 WP_000664338.1.45103 WP_000664338.1.45150 WP_000664338.1.45540 WP_000664338.1.45551 WP_000664338.1.45553 WP_000664338.1.45733 WP_000664338.1.45790 WP_000664338.1.45896 WP_000664338.1.45976 WP_000664338.1.46116 WP_000664338.1.46992 WP_000664338.1.47485 WP_000664338.1.47678 WP_000664338.1.48052 WP_000664338.1.48120 WP_000664338.1.48239 WP_000664338.1.48592 WP_000664338.1.48911 WP_000664338.1.48916 WP_000664338.1.49082 WP_000664338.1.49278 WP_000664338.1.49280 WP_000664338.1.49421 WP_000664338.1.49423 WP_000664338.1.49501 WP_000664338.1.49508 WP_000664338.1.49689 WP_000664338.1.49888 WP_000664338.1.49965 WP_000664338.1.50082 WP_000664338.1.5019 WP_000664338.1.50326 WP_000664338.1.50352 WP_000664338.1.50420 WP_000664338.1.5055 WP_000664338.1.5063 WP_000664338.1.50639 WP_000664338.1.50874 WP_000664338.1.50880 WP_000664338.1.50943 WP_000664338.1.50959 WP_000664338.1.51004 WP_000664338.1.51114 WP_000664338.1.5137 WP_000664338.1.51547 WP_000664338.1.51570 WP_000664338.1.51780 WP_000664338.1.52139 WP_000664338.1.52273 WP_000664338.1.52401 WP_000664338.1.52470 WP_000664338.1.52514 WP_000664338.1.52729 WP_000664338.1.52826 WP_000664338.1.52916 WP_000664338.1.52981 WP_000664338.1.53013 WP_000664338.1.53080 WP_000664338.1.53087 WP_000664338.1.5384 WP_000664338.1.54107 WP_000664338.1.54228 WP_000664338.1.54244 WP_000664338.1.5437 WP_000664338.1.54416 WP_000664338.1.54423 WP_000664338.1.5451 WP_000664338.1.54629 WP_000664338.1.54752 WP_000664338.1.54818 WP_000664338.1.54821 WP_000664338.1.55451 WP_000664338.1.55542 WP_000664338.1.55643 WP_000664338.1.55655 WP_000664338.1.55673 WP_000664338.1.55702 WP_000664338.1.55753 WP_000664338.1.55878 WP_000664338.1.56043 WP_000664338.1.56208 WP_000664338.1.564 WP_000664338.1.56404 WP_000664338.1.56602 WP_000664338.1.56930 WP_000664338.1.57174 WP_000664338.1.57262 WP_000664338.1.57320 WP_000664338.1.57347 WP_000664338.1.57368 WP_000664338.1.57407 WP_000664338.1.57557 WP_000664338.1.57586 WP_000664338.1.57721 WP_000664338.1.57900 WP_000664338.1.58075 WP_000664338.1.58119 WP_000664338.1.58254 WP_000664338.1.58313 WP_000664338.1.59040 WP_000664338.1.59057 WP_000664338.1.59196 WP_000664338.1.59460 WP_000664338.1.59565 WP_000664338.1.5977 WP_000664338.1.59837 WP_000664338.1.5999 WP_000664338.1.60058 WP_000664338.1.60093 WP_000664338.1.60159 WP_000664338.1.6055 WP_000664338.1.60593 WP_000664338.1.60702 WP_000664338.1.6096 WP_000664338.1.61032 WP_000664338.1.61267 WP_000664338.1.61433 WP_000664338.1.61458 WP_000664338.1.61554 WP_000664338.1.61581 WP_000664338.1.61676 WP_000664338.1.61790 WP_000664338.1.61844 WP_000664338.1.62057 WP_000664338.1.62267 WP_000664338.1.62362 WP_000664338.1.62758 WP_000664338.1.63086 WP_000664338.1.6321 WP_000664338.1.63363 WP_000664338.1.63367 WP_000664338.1.63394 WP_000664338.1.63482 WP_000664338.1.6360 WP_000664338.1.63764 WP_000664338.1.6383 WP_000664338.1.63980 WP_000664338.1.63991 WP_000664338.1.64182 WP_000664338.1.64206 WP_000664338.1.64297 WP_000664338.1.64352 WP_000664338.1.64459 WP_000664338.1.64468 WP_000664338.1.64560 WP_000664338.1.64640 WP_000664338.1.64713 WP_000664338.1.64967 WP_000664338.1.64975 WP_000664338.1.65010 WP_000664338.1.65059 WP_000664338.1.65139 WP_000664338.1.65195 WP_000664338.1.6526 WP_000664338.1.65287 WP_000664338.1.65323 WP_000664338.1.65427 WP_000664338.1.6564 WP_000664338.1.65668 WP_000664338.1.65918 WP_000664338.1.66063 WP_000664338.1.66242 WP_000664338.1.66372 WP_000664338.1.66680 WP_000664338.1.66732 WP_000664338.1.66784 WP_000664338.1.67008 WP_000664338.1.67162 WP_000664338.1.67318 WP_000664338.1.67444 WP_000664338.1.67476 WP_000664338.1.67680 WP_000664338.1.67759 WP_000664338.1.67859 WP_000664338.1.68143 WP_000664338.1.68234 WP_000664338.1.68290 WP_000664338.1.6840 WP_000664338.1.68413 WP_000664338.1.68587 WP_000664338.1.68732 WP_000664338.1.68788 WP_000664338.1.68827 WP_000664338.1.68867 WP_000664338.1.68890 WP_000664338.1.69023 WP_000664338.1.69034 WP_000664338.1.69077 WP_000664338.1.69101 WP_000664338.1.69132 WP_000664338.1.69163 WP_000664338.1.69705 WP_000664338.1.6986 WP_000664338.1.70053 WP_000664338.1.70219 WP_000664338.1.70276 WP_000664338.1.70286 WP_000664338.1.70397 WP_000664338.1.70562 WP_000664338.1.70932 WP_000664338.1.71044 WP_000664338.1.71075 WP_000664338.1.71237 WP_000664338.1.71554 WP_000664338.1.71643 WP_000664338.1.71709 WP_000664338.1.7191 WP_000664338.1.7234 WP_000664338.1.72381 WP_000664338.1.72464 WP_000664338.1.72821 WP_000664338.1.72949 WP_000664338.1.73030 WP_000664338.1.73082 WP_000664338.1.73137 WP_000664338.1.73184 WP_000664338.1.73417 WP_000664338.1.73421 WP_000664338.1.73439 WP_000664338.1.73449 WP_000664338.1.7350 WP_000664338.1.73585 WP_000664338.1.73621 WP_000664338.1.73637 WP_000664338.1.73692 WP_000664338.1.73696 WP_000664338.1.74179 WP_000664338.1.74188 WP_000664338.1.74717 WP_000664338.1.74933 WP_000664338.1.74951 WP_000664338.1.75020 WP_000664338.1.75077 WP_000664338.1.75293 WP_000664338.1.75819 WP_000664338.1.7586 WP_000664338.1.7587 WP_000664338.1.75882 WP_000664338.1.76023 WP_000664338.1.76033 WP_000664338.1.76034 WP_000664338.1.7620 WP_000664338.1.76408 WP_000664338.1.76490 WP_000664338.1.76610 WP_000664338.1.76906 WP_000664338.1.76996 WP_000664338.1.77005 WP_000664338.1.77138 WP_000664338.1.77300 WP_000664338.1.77757 WP_000664338.1.77945 WP_000664338.1.78006 WP_000664338.1.78251 WP_000664338.1.78262 WP_000664338.1.78292 WP_000664338.1.7835 WP_000664338.1.78356 WP_000664338.1.78432 WP_000664338.1.78464 WP_000664338.1.78480 WP_000664338.1.7882 WP_000664338.1.78990 WP_000664338.1.7904 WP_000664338.1.791 WP_000664338.1.79117 WP_000664338.1.79135 WP_000664338.1.79372 WP_000664338.1.79474 WP_000664338.1.79724 WP_000664338.1.80180 WP_000664338.1.80340 WP_000664338.1.80438 WP_000664338.1.80460 WP_000664338.1.80706 WP_000664338.1.8099 WP_000664338.1.81006 WP_000664338.1.81115 WP_000664338.1.81168 WP_000664338.1.81303 WP_000664338.1.81477 WP_000664338.1.81506 WP_000664338.1.82198 WP_000664338.1.82293 WP_000664338.1.825 WP_000664338.1.82501 WP_000664338.1.82541 WP_000664338.1.82730 WP_000664338.1.82982 WP_000664338.1.83071 WP_000664338.1.83198 WP_000664338.1.8340 WP_000664338.1.83465 WP_000664338.1.83494 WP_000664338.1.83616 WP_000664338.1.8362 WP_000664338.1.83944 WP_000664338.1.84093 WP_000664338.1.84119 WP_000664338.1.84227 WP_000664338.1.84273 WP_000664338.1.84343 WP_000664338.1.84707 WP_000664338.1.85030 WP_000664338.1.85179 WP_000664338.1.852 WP_000664338.1.85296 WP_000664338.1.85605 WP_000664338.1.85914 WP_000664338.1.85966 WP_000664338.1.8625 WP_000664338.1.86366 WP_000664338.1.86497 WP_000664338.1.86500 WP_000664338.1.86532 WP_000664338.1.86535 WP_000664338.1.86635 WP_000664338.1.86651 WP_000664338.1.86972 WP_000664338.1.87011 WP_000664338.1.87030 WP_000664338.1.87033 WP_000664338.1.87251 WP_000664338.1.87307 WP_000664338.1.87380 WP_000664338.1.87395 WP_000664338.1.87807 WP_000664338.1.87880 WP_000664338.1.87882 WP_000664338.1.88071 WP_000664338.1.88209 WP_000664338.1.88262 WP_000664338.1.88296 WP_000664338.1.88344 WP_000664338.1.88345 WP_000664338.1.88429 WP_000664338.1.8861 WP_000664338.1.887 WP_000664338.1.88701 WP_000664338.1.88744 WP_000664338.1.89132 WP_000664338.1.89248 WP_000664338.1.89303 WP_000664338.1.89336 WP_000664338.1.89477 WP_000664338.1.89574 WP_000664338.1.89608 WP_000664338.1.89890 WP_000664338.1.90019 WP_000664338.1.90068 WP_000664338.1.90129 WP_000664338.1.90214 WP_000664338.1.90411 WP_000664338.1.90530 WP_000664338.1.90664 WP_000664338.1.90666 WP_000664338.1.90749 WP_000664338.1.90867 WP_000664338.1.90941 WP_000664338.1.9099 WP_000664338.1.91002 WP_000664338.1.91223 WP_000664338.1.91285 WP_000664338.1.9136 WP_000664338.1.91673 WP_000664338.1.91731 WP_000664338.1.92126 WP_000664338.1.92152 WP_000664338.1.92184 WP_000664338.1.92219 WP_000664338.1.92320 WP_000664338.1.92547 WP_000664338.1.92590 WP_000664338.1.92647 WP_000664338.1.92762 WP_000664338.1.9295 WP_000664338.1.93080 WP_000664338.1.933 WP_000664338.1.93303 WP_000664338.1.93323 WP_000664338.1.93537 WP_000664338.1.93734 WP_000664338.1.93793 WP_000664338.1.93825 WP_000664338.1.9386 WP_000664338.1.93881 WP_000664338.1.93884 WP_000664338.1.94109 WP_000664338.1.94194 WP_000664338.1.94346 WP_000664338.1.94370 WP_000664338.1.94457 WP_000664338.1.94532 WP_000664338.1.94803 WP_000664338.1.94868 WP_000664338.1.94973 WP_000664338.1.95328 WP_000664338.1.95658 WP_000664338.1.95950 WP_000664338.1.96087 WP_000664338.1.96116 WP_000664338.1.96137 WP_000664338.1.96406 WP_000664338.1.96485 WP_000664338.1.96768 WP_000664338.1.96868 WP_000664338.1.96943 WP_000664338.1.9711 WP_000664338.1.9741 WP_000664338.1.97621 WP_000664338.1.97836 WP_000664338.1.97850 WP_000664338.1.98063 WP_000664338.1.98185 WP_000664338.1.9822 WP_000664338.1.98346 WP_000664338.1.98370 WP_000664338.1.98584 WP_000664338.1.98638 WP_000664338.1.98766 WP_000664338.1.98773 WP_000664338.1.98832 WP_000664338.1.98979 WP_000664338.1.99017 WP_000664338.1.99019 WP_000664338.1.99056 WP_000664338.1.99241 WP_000664338.1.99286 WP_000664338.1.99447 WP_000664338.1.99728 WP_000664338.1.99946 205921.SAK_1786 208435.SAG1764 gi|512545518|ref|YP_008087631.1| gi|76788373|ref|YP_330383.1| gi|512539978|ref|YP_008085482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]