SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76788408|ref|YP_330637.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76788408|ref|YP_330637.1|
Domain Number 1 Region: 3-319
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.42e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000235
Further Details:      
 
Domain Number 2 Region: 328-415
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.55e-20
Family Anticodon-binding domain of Class II aaRS 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76788408|ref|YP_330637.1|
Sequence length 426
Comment histidyl-tRNA synthetase [Streptococcus agalactiae A909]
Sequence
MKLQKPKGTQDILPGESAKWQYVENVIRNLFKQYHYDEIRTPMFEHYEVISRSVGDTTDI
VTKEMYDFHDKGDRHITLRPEGTAPVVRSYVENKLFAPEVQKPTKMYYIGSMFRYERPQA
GRLREFHQVGVECFGSNNPATDVETIAMGHHLFEDLGIKNVKLHLNSLGSPESRQAYRQA
LIDYLTPIREQLSKDSQRRLNENPLRVLDSKEPEDKLAVENAPSILDYLDESSQAHFDAV
CHMLDALNIPYIIDTNMVRGLDYYNHTIFEFITEIEDNELTICAGGRYDGLVSYFGGPET
PAFGFGLGLERLLLILGKQGIPLPIENTIDLYIAVLGSEANLAALDLAQSIRHQGFKVER
DYLGRKIKAQFKSADTFNAKVIMTLGSSEVDSREVSLKNNQTRQEVKVSFENIKTGFSSV
LKQLGL
Download sequence
Identical sequences A0A0E1EK35 Q3JYL6
gi|76788408|ref|YP_330637.1| 205921.SAK_2047 gi|512699439|ref|YP_008118724.1| gi|512540236|ref|YP_008085740.1| gi|406710418|ref|YP_006765144.1| WP_000775906.1.10029 WP_000775906.1.100367 WP_000775906.1.100766 WP_000775906.1.101222 WP_000775906.1.101267 WP_000775906.1.101296 WP_000775906.1.101830 WP_000775906.1.101853 WP_000775906.1.101864 WP_000775906.1.10371 WP_000775906.1.10723 WP_000775906.1.10924 WP_000775906.1.11465 WP_000775906.1.12166 WP_000775906.1.1251 WP_000775906.1.12619 WP_000775906.1.12688 WP_000775906.1.12755 WP_000775906.1.12978 WP_000775906.1.13064 WP_000775906.1.13285 WP_000775906.1.14275 WP_000775906.1.14324 WP_000775906.1.1437 WP_000775906.1.14563 WP_000775906.1.14738 WP_000775906.1.14953 WP_000775906.1.14960 WP_000775906.1.15526 WP_000775906.1.15556 WP_000775906.1.16134 WP_000775906.1.16165 WP_000775906.1.16342 WP_000775906.1.16535 WP_000775906.1.16595 WP_000775906.1.17339 WP_000775906.1.17489 WP_000775906.1.1760 WP_000775906.1.1775 WP_000775906.1.18425 WP_000775906.1.18450 WP_000775906.1.18829 WP_000775906.1.18841 WP_000775906.1.18933 WP_000775906.1.19892 WP_000775906.1.20123 WP_000775906.1.20188 WP_000775906.1.20326 WP_000775906.1.20847 WP_000775906.1.21522 WP_000775906.1.21525 WP_000775906.1.21722 WP_000775906.1.22004 WP_000775906.1.22139 WP_000775906.1.23380 WP_000775906.1.23384 WP_000775906.1.24441 WP_000775906.1.24475 WP_000775906.1.24845 WP_000775906.1.25781 WP_000775906.1.26056 WP_000775906.1.2651 WP_000775906.1.26791 WP_000775906.1.26827 WP_000775906.1.27024 WP_000775906.1.2754 WP_000775906.1.27583 WP_000775906.1.27880 WP_000775906.1.27958 WP_000775906.1.28021 WP_000775906.1.29163 WP_000775906.1.29238 WP_000775906.1.29352 WP_000775906.1.29888 WP_000775906.1.30062 WP_000775906.1.30252 WP_000775906.1.30703 WP_000775906.1.30710 WP_000775906.1.3074 WP_000775906.1.3112 WP_000775906.1.3166 WP_000775906.1.31888 WP_000775906.1.32520 WP_000775906.1.32728 WP_000775906.1.32818 WP_000775906.1.33723 WP_000775906.1.34227 WP_000775906.1.34276 WP_000775906.1.34467 WP_000775906.1.34475 WP_000775906.1.34896 WP_000775906.1.34906 WP_000775906.1.35428 WP_000775906.1.36095 WP_000775906.1.36408 WP_000775906.1.36800 WP_000775906.1.36878 WP_000775906.1.36977 WP_000775906.1.37018 WP_000775906.1.37098 WP_000775906.1.37523 WP_000775906.1.38578 WP_000775906.1.38699 WP_000775906.1.3880 WP_000775906.1.38842 WP_000775906.1.3930 WP_000775906.1.39386 WP_000775906.1.3963 WP_000775906.1.40015 WP_000775906.1.40203 WP_000775906.1.40359 WP_000775906.1.41399 WP_000775906.1.41663 WP_000775906.1.41785 WP_000775906.1.4215 WP_000775906.1.42844 WP_000775906.1.43199 WP_000775906.1.44371 WP_000775906.1.44374 WP_000775906.1.44712 WP_000775906.1.44746 WP_000775906.1.45 WP_000775906.1.45103 WP_000775906.1.45150 WP_000775906.1.45540 WP_000775906.1.45896 WP_000775906.1.45976 WP_000775906.1.46116 WP_000775906.1.46992 WP_000775906.1.47485 WP_000775906.1.48052 WP_000775906.1.48239 WP_000775906.1.49421 WP_000775906.1.50326 WP_000775906.1.5055 WP_000775906.1.50639 WP_000775906.1.50874 WP_000775906.1.51102 WP_000775906.1.51114 WP_000775906.1.51780 WP_000775906.1.52273 WP_000775906.1.52401 WP_000775906.1.52470 WP_000775906.1.52826 WP_000775906.1.52916 WP_000775906.1.52981 WP_000775906.1.54416 WP_000775906.1.54423 WP_000775906.1.54818 WP_000775906.1.55451 WP_000775906.1.55753 WP_000775906.1.564 WP_000775906.1.56404 WP_000775906.1.56602 WP_000775906.1.56930 WP_000775906.1.57174 WP_000775906.1.57407 WP_000775906.1.57557 WP_000775906.1.57586 WP_000775906.1.57721 WP_000775906.1.57900 WP_000775906.1.58075 WP_000775906.1.59565 WP_000775906.1.5977 WP_000775906.1.60159 WP_000775906.1.60593 WP_000775906.1.61267 WP_000775906.1.61458 WP_000775906.1.61676 WP_000775906.1.61790 WP_000775906.1.62057 WP_000775906.1.62362 WP_000775906.1.62758 WP_000775906.1.6321 WP_000775906.1.63363 WP_000775906.1.63482 WP_000775906.1.6360 WP_000775906.1.63764 WP_000775906.1.63980 WP_000775906.1.64206 WP_000775906.1.64297 WP_000775906.1.64459 WP_000775906.1.64468 WP_000775906.1.64713 WP_000775906.1.64975 WP_000775906.1.65195 WP_000775906.1.65297 WP_000775906.1.65323 WP_000775906.1.6564 WP_000775906.1.66242 WP_000775906.1.67008 WP_000775906.1.67162 WP_000775906.1.67318 WP_000775906.1.67444 WP_000775906.1.67476 WP_000775906.1.67759 WP_000775906.1.68290 WP_000775906.1.6840 WP_000775906.1.68443 WP_000775906.1.68587 WP_000775906.1.68788 WP_000775906.1.68827 WP_000775906.1.69023 WP_000775906.1.69077 WP_000775906.1.69101 WP_000775906.1.69132 WP_000775906.1.70219 WP_000775906.1.70276 WP_000775906.1.70286 WP_000775906.1.70397 WP_000775906.1.71044 WP_000775906.1.71237 WP_000775906.1.71554 WP_000775906.1.7191 WP_000775906.1.7234 WP_000775906.1.72381 WP_000775906.1.72464 WP_000775906.1.73082 WP_000775906.1.73137 WP_000775906.1.73417 WP_000775906.1.73637 WP_000775906.1.73696 WP_000775906.1.74188 WP_000775906.1.74951 WP_000775906.1.75020 WP_000775906.1.75077 WP_000775906.1.75293 WP_000775906.1.7586 WP_000775906.1.76034 WP_000775906.1.7620 WP_000775906.1.76408 WP_000775906.1.76610 WP_000775906.1.76906 WP_000775906.1.76996 WP_000775906.1.77005 WP_000775906.1.77945 WP_000775906.1.78251 WP_000775906.1.78432 WP_000775906.1.78464 WP_000775906.1.7882 WP_000775906.1.79135 WP_000775906.1.79474 WP_000775906.1.79724 WP_000775906.1.80180 WP_000775906.1.80706 WP_000775906.1.81115 WP_000775906.1.81168 WP_000775906.1.81303 WP_000775906.1.81506 WP_000775906.1.82293 WP_000775906.1.82501 WP_000775906.1.82730 WP_000775906.1.8340 WP_000775906.1.83616 WP_000775906.1.8362 WP_000775906.1.84119 WP_000775906.1.84227 WP_000775906.1.84343 WP_000775906.1.85179 WP_000775906.1.852 WP_000775906.1.85296 WP_000775906.1.85914 WP_000775906.1.86532 WP_000775906.1.86535 WP_000775906.1.87011 WP_000775906.1.87033 WP_000775906.1.87307 WP_000775906.1.87395 WP_000775906.1.87807 WP_000775906.1.87880 WP_000775906.1.87882 WP_000775906.1.88071 WP_000775906.1.88296 WP_000775906.1.88344 WP_000775906.1.887 WP_000775906.1.89248 WP_000775906.1.89303 WP_000775906.1.89477 WP_000775906.1.89574 WP_000775906.1.89608 WP_000775906.1.90068 WP_000775906.1.90214 WP_000775906.1.90411 WP_000775906.1.90530 WP_000775906.1.90664 WP_000775906.1.90666 WP_000775906.1.90867 WP_000775906.1.90941 WP_000775906.1.91002 WP_000775906.1.91223 WP_000775906.1.91285 WP_000775906.1.91673 WP_000775906.1.91731 WP_000775906.1.92219 WP_000775906.1.92320 WP_000775906.1.92590 WP_000775906.1.92647 WP_000775906.1.933 WP_000775906.1.93303 WP_000775906.1.93323 WP_000775906.1.93537 WP_000775906.1.9386 WP_000775906.1.93884 WP_000775906.1.94370 WP_000775906.1.94532 WP_000775906.1.94803 WP_000775906.1.95950 WP_000775906.1.96087 WP_000775906.1.96406 WP_000775906.1.96868 WP_000775906.1.96943 WP_000775906.1.9741 WP_000775906.1.97621 WP_000775906.1.97836 WP_000775906.1.97850 WP_000775906.1.98063 WP_000775906.1.9822 WP_000775906.1.98773 WP_000775906.1.98979 WP_000775906.1.99017 WP_000775906.1.99019 WP_000775906.1.99056 WP_000775906.1.99241 WP_000775906.1.99286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]