SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76788418|ref|YP_329556.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76788418|ref|YP_329556.1|
Domain Number 1 Region: 5-248
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.73e-79
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000059
Further Details:      
 
Domain Number 2 Region: 249-441
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 5.36e-65
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000273
Further Details:      
 
Domain Number 3 Region: 555-713
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.98e-52
Family AlaX-like 0.072
Further Details:      
 
Domain Number 4 Region: 482-554
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000847
Family AlaX-M N-terminal domain-like 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|76788418|ref|YP_329556.1|
Domain Number - Region: 760-818
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0151
Family Tyrosine-dependent oxidoreductases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76788418|ref|YP_329556.1|
Sequence length 872
Comment alanyl-tRNA synthetase [Streptococcus agalactiae A909]
Sequence
MKELSSAQIRQMWLDFWKSKGHSVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPEN
PRITNAQKSIRTNDIENVGKTARHHTMFEMLGNFSIGDYFRDEAIEWGFELLTSPEWFDF
PKDKLYMTYYPDDKDSYNRWIACGVEPSHLVPIEDNFWEIGAGPSGPDTEIFFDRGEDFD
PENIGLRLLAEDIENDRYIEIWNIVLSQFNADPAVPRSEYKELPNKNIDTGAGLERLAAV
MQGAKTNFETDLFMPIIREVEKLSGKTYDPDGDNMSFKVIADHIRALSFAIGDGALPGNE
GRGYVLRRLLRRAVMHGRRLGINETFLYKLVPTVGQIMESYYPEVLEKRDFIEKIVKREE
ETFARTIDAGSGHLDSLLAQLKAEGKDTLEGKDIFKLYDTYGFPVELTEELAEDADYKID
HEGFKAAMKEQQDRARAAVVKGGSMGMQNETLAGIVEESRFDYGADSLESNLSVIIADNE
RTEAVSEGQALLVFAQTPFYAEMGGQVADHGVIKNDKGDTVAEVVDVQKAPNGQPLHTVN
VLASLSVGTNYTLEINKERRLAVEKNHTATHLLHAALHNVIGEHATQAGSLNEEEFLRFD
FTHFEAVSNEELRHIEQEVNEQIWNDLTITTTETDVETAKEMGAMALFGEKYGKVVRVVQ
IGNYSVELCGGTHLNNSSEIGLFKIVKEEGIGSGTRRIIAVTGRQAFEAYRNQEDALKEI
AATVKAPQLKDAAAKVQALSDSLRDLQKENVELKEKAAAAAAGDVFKDIQEAKGVRFIAS
QVDVADAGALRTFADNWKQKDYSDVLVLVAAIGEKVNVLVASKTKDVHAGNMIKGLAPIV
AGRGGGKPDMAMAGGSDASKIAELLAAVAENL
Download sequence
Identical sequences Q3K1P7
gi|406709300|ref|YP_006764026.1| gi|76788418|ref|YP_329556.1| 205921.SAK_0934 WP_000661553.1.12978 WP_000661553.1.20188 WP_000661553.1.22004 WP_000661553.1.30710 WP_000661553.1.32728 WP_000661553.1.34906 WP_000661553.1.36878 WP_000661553.1.3963 WP_000661553.1.45150 WP_000661553.1.47485 WP_000661553.1.48239 WP_000661553.1.57721 WP_000661553.1.59565 WP_000661553.1.61790 WP_000661553.1.67008 WP_000661553.1.79135 WP_000661553.1.81168 WP_000661553.1.81506 WP_000661553.1.83616 WP_000661553.1.87033 WP_000661553.1.89303 WP_000661553.1.90530 WP_000661553.1.90666 WP_000661553.1.90941 WP_000661553.1.933 WP_000661553.1.94370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]