SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76788589|ref|YP_329614.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76788589|ref|YP_329614.1|
Domain Number 1 Region: 97-346
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000048
Further Details:      
 
Domain Number 2 Region: 24-104
Classification Level Classification E-value
Superfamily tRNA-binding arm 3.19e-18
Family Phenylalanyl-tRNA synthetase (PheRS) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76788589|ref|YP_329614.1|
Sequence length 346
Comment phenylalanyl-tRNA synthetase subunit alpha [Streptococcus agalactiae A909]
Sequence
MDLQKQLEELKISTQEKLKEMTGNHTKELQDLRVQVLGKKGSLTELLKGLKDLSNDLRPV
VGKQVNEVRDILTKAFEEQAKVVEAAKIQAQLESESVDVTLPGRQMTLGHRHVLTQTSEE
IEDIFLGMGFQVVDGFEVEKDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQA
RTMDQHDFSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGENISMGDLKGTLQLIS
QKMFGAERKIRLRPSYFPFTEPSVEVDVSCFKCGGKGCNVCKQTGWIEILGAGMVHPSVL
EMSGIDSEKYSGFAFGLGQERIAMLRYGINDIRGFYQGDVRFTDQF
Download sequence
Identical sequences A0A1F0CGU9 A0A1J7V9H3 E7S4P8 F8Y014 Q3K1I9 Q8E066 R4Z913 S8FNX5 S8FQI8 S8G3S5 S8GDK1 S8NQH3 S8QE52 S8QIE0 S9BI78 S9CB76 S9CLH5 S9CQT6 S9MRI6
gi|512544644|ref|YP_008086757.1| 205921.SAK_0992 208435.SAG0869 gi|22537032|ref|NP_687883.1| gi|512539105|ref|YP_008084609.1| gi|494703052|ref|YP_007968513.1| gi|410594425|ref|YP_006951152.1| gi|406709358|ref|YP_006764084.1| gi|76788589|ref|YP_329614.1| gi|512698347|ref|YP_008117632.1| NP_687883.1.71890 WP_000365655.1.100037 WP_000365655.1.100058 WP_000365655.1.100254 WP_000365655.1.10029 WP_000365655.1.100296 WP_000365655.1.100355 WP_000365655.1.100367 WP_000365655.1.100766 WP_000365655.1.100991 WP_000365655.1.101195 WP_000365655.1.101208 WP_000365655.1.101222 WP_000365655.1.101267 WP_000365655.1.101283 WP_000365655.1.101296 WP_000365655.1.101328 WP_000365655.1.101830 WP_000365655.1.101853 WP_000365655.1.101864 WP_000365655.1.101938 WP_000365655.1.101956 WP_000365655.1.102056 WP_000365655.1.10297 WP_000365655.1.10371 WP_000365655.1.10618 WP_000365655.1.10620 WP_000365655.1.10645 WP_000365655.1.1067 WP_000365655.1.10676 WP_000365655.1.10723 WP_000365655.1.10924 WP_000365655.1.11248 WP_000365655.1.11343 WP_000365655.1.11446 WP_000365655.1.11465 WP_000365655.1.1163 WP_000365655.1.11756 WP_000365655.1.11774 WP_000365655.1.11941 WP_000365655.1.12072 WP_000365655.1.12166 WP_000365655.1.12215 WP_000365655.1.12249 WP_000365655.1.12331 WP_000365655.1.12363 WP_000365655.1.1251 WP_000365655.1.12688 WP_000365655.1.12755 WP_000365655.1.1293 WP_000365655.1.12978 WP_000365655.1.13008 WP_000365655.1.13064 WP_000365655.1.13167 WP_000365655.1.13285 WP_000365655.1.13384 WP_000365655.1.13493 WP_000365655.1.13553 WP_000365655.1.13737 WP_000365655.1.13885 WP_000365655.1.1402 WP_000365655.1.14040 WP_000365655.1.14140 WP_000365655.1.14275 WP_000365655.1.14324 WP_000365655.1.14368 WP_000365655.1.1437 WP_000365655.1.14429 WP_000365655.1.14563 WP_000365655.1.14738 WP_000365655.1.14953 WP_000365655.1.14960 WP_000365655.1.15385 WP_000365655.1.15417 WP_000365655.1.15556 WP_000365655.1.16134 WP_000365655.1.16165 WP_000365655.1.1633 WP_000365655.1.16335 WP_000365655.1.16342 WP_000365655.1.16528 WP_000365655.1.16535 WP_000365655.1.16580 WP_000365655.1.16595 WP_000365655.1.16706 WP_000365655.1.16976 WP_000365655.1.17056 WP_000365655.1.17074 WP_000365655.1.17243 WP_000365655.1.17339 WP_000365655.1.17380 WP_000365655.1.17489 WP_000365655.1.17506 WP_000365655.1.1760 WP_000365655.1.17709 WP_000365655.1.1775 WP_000365655.1.18003 WP_000365655.1.18047 WP_000365655.1.18263 WP_000365655.1.18362 WP_000365655.1.18425 WP_000365655.1.18450 WP_000365655.1.18747 WP_000365655.1.1882 WP_000365655.1.18829 WP_000365655.1.18841 WP_000365655.1.18933 WP_000365655.1.19073 WP_000365655.1.19086 WP_000365655.1.19604 WP_000365655.1.19892 WP_000365655.1.19950 WP_000365655.1.20123 WP_000365655.1.20188 WP_000365655.1.20258 WP_000365655.1.20326 WP_000365655.1.20350 WP_000365655.1.20458 WP_000365655.1.20511 WP_000365655.1.20717 WP_000365655.1.20726 WP_000365655.1.20791 WP_000365655.1.20847 WP_000365655.1.21061 WP_000365655.1.21087 WP_000365655.1.21280 WP_000365655.1.21522 WP_000365655.1.21525 WP_000365655.1.21722 WP_000365655.1.21779 WP_000365655.1.21860 WP_000365655.1.2195 WP_000365655.1.22004 WP_000365655.1.22076 WP_000365655.1.22087 WP_000365655.1.22139 WP_000365655.1.222 WP_000365655.1.22247 WP_000365655.1.22552 WP_000365655.1.22749 WP_000365655.1.22801 WP_000365655.1.23380 WP_000365655.1.23508 WP_000365655.1.24162 WP_000365655.1.24441 WP_000365655.1.24475 WP_000365655.1.24559 WP_000365655.1.24827 WP_000365655.1.24845 WP_000365655.1.25002 WP_000365655.1.2509 WP_000365655.1.25303 WP_000365655.1.2555 WP_000365655.1.25670 WP_000365655.1.25781 WP_000365655.1.25973 WP_000365655.1.25985 WP_000365655.1.25998 WP_000365655.1.26029 WP_000365655.1.26046 WP_000365655.1.26056 WP_000365655.1.26153 WP_000365655.1.26174 WP_000365655.1.26258 WP_000365655.1.26300 WP_000365655.1.26312 WP_000365655.1.26357 WP_000365655.1.26386 WP_000365655.1.2651 WP_000365655.1.26791 WP_000365655.1.26827 WP_000365655.1.27024 WP_000365655.1.27184 WP_000365655.1.27325 WP_000365655.1.2754 WP_000365655.1.27583 WP_000365655.1.27751 WP_000365655.1.2781 WP_000365655.1.27880 WP_000365655.1.27958 WP_000365655.1.28021 WP_000365655.1.28197 WP_000365655.1.28342 WP_000365655.1.2844 WP_000365655.1.28613 WP_000365655.1.28624 WP_000365655.1.28738 WP_000365655.1.28991 WP_000365655.1.29020 WP_000365655.1.29163 WP_000365655.1.29238 WP_000365655.1.29352 WP_000365655.1.29410 WP_000365655.1.29470 WP_000365655.1.29532 WP_000365655.1.29719 WP_000365655.1.29888 WP_000365655.1.30062 WP_000365655.1.30182 WP_000365655.1.30200 WP_000365655.1.30252 WP_000365655.1.30310 WP_000365655.1.30450 WP_000365655.1.3052 WP_000365655.1.30603 WP_000365655.1.30703 WP_000365655.1.30710 WP_000365655.1.3074 WP_000365655.1.30831 WP_000365655.1.30974 WP_000365655.1.31109 WP_000365655.1.3112 WP_000365655.1.3166 WP_000365655.1.31888 WP_000365655.1.31896 WP_000365655.1.32511 WP_000365655.1.32520 WP_000365655.1.32603 WP_000365655.1.32728 WP_000365655.1.32745 WP_000365655.1.32818 WP_000365655.1.33723 WP_000365655.1.34174 WP_000365655.1.34227 WP_000365655.1.34276 WP_000365655.1.34467 WP_000365655.1.34475 WP_000365655.1.34828 WP_000365655.1.34896 WP_000365655.1.34906 WP_000365655.1.34981 WP_000365655.1.35119 WP_000365655.1.35399 WP_000365655.1.35428 WP_000365655.1.35443 WP_000365655.1.35621 WP_000365655.1.35908 WP_000365655.1.35937 WP_000365655.1.36095 WP_000365655.1.36202 WP_000365655.1.36258 WP_000365655.1.36403 WP_000365655.1.36408 WP_000365655.1.3658 WP_000365655.1.36726 WP_000365655.1.36776 WP_000365655.1.36800 WP_000365655.1.36878 WP_000365655.1.3691 WP_000365655.1.36977 WP_000365655.1.37018 WP_000365655.1.37098 WP_000365655.1.37124 WP_000365655.1.37523 WP_000365655.1.37570 WP_000365655.1.37692 WP_000365655.1.3814 WP_000365655.1.38237 WP_000365655.1.3845 WP_000365655.1.38456 WP_000365655.1.38578 WP_000365655.1.38699 WP_000365655.1.3880 WP_000365655.1.38842 WP_000365655.1.38910 WP_000365655.1.3927 WP_000365655.1.3930 WP_000365655.1.3937 WP_000365655.1.39381 WP_000365655.1.39386 WP_000365655.1.39495 WP_000365655.1.3963 WP_000365655.1.40015 WP_000365655.1.40055 WP_000365655.1.40203 WP_000365655.1.40241 WP_000365655.1.40359 WP_000365655.1.40538 WP_000365655.1.40694 WP_000365655.1.40765 WP_000365655.1.40812 WP_000365655.1.41269 WP_000365655.1.41338 WP_000365655.1.41399 WP_000365655.1.41646 WP_000365655.1.41663 WP_000365655.1.41785 WP_000365655.1.41865 WP_000365655.1.42144 WP_000365655.1.4215 WP_000365655.1.42225 WP_000365655.1.42271 WP_000365655.1.42477 WP_000365655.1.42686 WP_000365655.1.42844 WP_000365655.1.43199 WP_000365655.1.4323 WP_000365655.1.43571 WP_000365655.1.43981 WP_000365655.1.44371 WP_000365655.1.44374 WP_000365655.1.4446 WP_000365655.1.44614 WP_000365655.1.44712 WP_000365655.1.44727 WP_000365655.1.44746 WP_000365655.1.44957 WP_000365655.1.45 WP_000365655.1.45058 WP_000365655.1.45103 WP_000365655.1.45150 WP_000365655.1.45180 WP_000365655.1.45540 WP_000365655.1.45551 WP_000365655.1.45553 WP_000365655.1.45733 WP_000365655.1.45782 WP_000365655.1.45790 WP_000365655.1.45896 WP_000365655.1.45976 WP_000365655.1.46116 WP_000365655.1.46747 WP_000365655.1.46790 WP_000365655.1.46992 WP_000365655.1.47044 WP_000365655.1.47485 WP_000365655.1.47608 WP_000365655.1.47678 WP_000365655.1.48052 WP_000365655.1.48120 WP_000365655.1.48239 WP_000365655.1.48502 WP_000365655.1.48592 WP_000365655.1.48911 WP_000365655.1.48916 WP_000365655.1.49278 WP_000365655.1.49280 WP_000365655.1.49421 WP_000365655.1.49423 WP_000365655.1.49501 WP_000365655.1.49508 WP_000365655.1.49689 WP_000365655.1.49888 WP_000365655.1.49965 WP_000365655.1.50082 WP_000365655.1.5019 WP_000365655.1.50326 WP_000365655.1.50352 WP_000365655.1.50420 WP_000365655.1.5055 WP_000365655.1.50552 WP_000365655.1.5063 WP_000365655.1.50639 WP_000365655.1.50776 WP_000365655.1.50874 WP_000365655.1.50880 WP_000365655.1.50943 WP_000365655.1.50959 WP_000365655.1.51004 WP_000365655.1.51102 WP_000365655.1.51114 WP_000365655.1.5137 WP_000365655.1.51547 WP_000365655.1.51570 WP_000365655.1.51780 WP_000365655.1.52139 WP_000365655.1.52273 WP_000365655.1.52401 WP_000365655.1.52470 WP_000365655.1.52514 WP_000365655.1.52634 WP_000365655.1.52729 WP_000365655.1.52826 WP_000365655.1.52916 WP_000365655.1.52981 WP_000365655.1.53013 WP_000365655.1.53080 WP_000365655.1.53087 WP_000365655.1.5384 WP_000365655.1.54107 WP_000365655.1.54228 WP_000365655.1.54244 WP_000365655.1.5437 WP_000365655.1.54416 WP_000365655.1.54423 WP_000365655.1.54487 WP_000365655.1.54629 WP_000365655.1.54752 WP_000365655.1.54818 WP_000365655.1.54821 WP_000365655.1.54896 WP_000365655.1.55451 WP_000365655.1.55542 WP_000365655.1.55643 WP_000365655.1.55702 WP_000365655.1.55753 WP_000365655.1.55878 WP_000365655.1.56043 WP_000365655.1.56208 WP_000365655.1.564 WP_000365655.1.56404 WP_000365655.1.56590 WP_000365655.1.56602 WP_000365655.1.56930 WP_000365655.1.57174 WP_000365655.1.57262 WP_000365655.1.57320 WP_000365655.1.57347 WP_000365655.1.57368 WP_000365655.1.57407 WP_000365655.1.57557 WP_000365655.1.57586 WP_000365655.1.57721 WP_000365655.1.57756 WP_000365655.1.57900 WP_000365655.1.58075 WP_000365655.1.58119 WP_000365655.1.58208 WP_000365655.1.58254 WP_000365655.1.58313 WP_000365655.1.58988 WP_000365655.1.59040 WP_000365655.1.59057 WP_000365655.1.59196 WP_000365655.1.59565 WP_000365655.1.5977 WP_000365655.1.59837 WP_000365655.1.60058 WP_000365655.1.60093 WP_000365655.1.60159 WP_000365655.1.60290 WP_000365655.1.6055 WP_000365655.1.60593 WP_000365655.1.60702 WP_000365655.1.6096 WP_000365655.1.61032 WP_000365655.1.61267 WP_000365655.1.61433 WP_000365655.1.61458 WP_000365655.1.61554 WP_000365655.1.61581 WP_000365655.1.61676 WP_000365655.1.61790 WP_000365655.1.61844 WP_000365655.1.62057 WP_000365655.1.62267 WP_000365655.1.62362 WP_000365655.1.62758 WP_000365655.1.63086 WP_000365655.1.6321 WP_000365655.1.63363 WP_000365655.1.63367 WP_000365655.1.63394 WP_000365655.1.63482 WP_000365655.1.6360 WP_000365655.1.63764 WP_000365655.1.6383 WP_000365655.1.63980 WP_000365655.1.63991 WP_000365655.1.64182 WP_000365655.1.64206 WP_000365655.1.64297 WP_000365655.1.64352 WP_000365655.1.64459 WP_000365655.1.64468 WP_000365655.1.64560 WP_000365655.1.64640 WP_000365655.1.64651 WP_000365655.1.64713 WP_000365655.1.64967 WP_000365655.1.64975 WP_000365655.1.65010 WP_000365655.1.65036 WP_000365655.1.65059 WP_000365655.1.6512 WP_000365655.1.65139 WP_000365655.1.65195 WP_000365655.1.6526 WP_000365655.1.65287 WP_000365655.1.65297 WP_000365655.1.65323 WP_000365655.1.65324 WP_000365655.1.6564 WP_000365655.1.65918 WP_000365655.1.66063 WP_000365655.1.66242 WP_000365655.1.66372 WP_000365655.1.66680 WP_000365655.1.66732 WP_000365655.1.66784 WP_000365655.1.67008 WP_000365655.1.67162 WP_000365655.1.67318 WP_000365655.1.67444 WP_000365655.1.67476 WP_000365655.1.67680 WP_000365655.1.67759 WP_000365655.1.67859 WP_000365655.1.68143 WP_000365655.1.68234 WP_000365655.1.68290 WP_000365655.1.6840 WP_000365655.1.68413 WP_000365655.1.68443 WP_000365655.1.68587 WP_000365655.1.68641 WP_000365655.1.68732 WP_000365655.1.68788 WP_000365655.1.68827 WP_000365655.1.68867 WP_000365655.1.68890 WP_000365655.1.69023 WP_000365655.1.69034 WP_000365655.1.69077 WP_000365655.1.69132 WP_000365655.1.69163 WP_000365655.1.69705 WP_000365655.1.70053 WP_000365655.1.70219 WP_000365655.1.70242 WP_000365655.1.70276 WP_000365655.1.70286 WP_000365655.1.70391 WP_000365655.1.70397 WP_000365655.1.70562 WP_000365655.1.70742 WP_000365655.1.70879 WP_000365655.1.70932 WP_000365655.1.71044 WP_000365655.1.71075 WP_000365655.1.71237 WP_000365655.1.71554 WP_000365655.1.71606 WP_000365655.1.71643 WP_000365655.1.71709 WP_000365655.1.7191 WP_000365655.1.7234 WP_000365655.1.72381 WP_000365655.1.72464 WP_000365655.1.72821 WP_000365655.1.72949 WP_000365655.1.73030 WP_000365655.1.73082 WP_000365655.1.73137 WP_000365655.1.73184 WP_000365655.1.73417 WP_000365655.1.73421 WP_000365655.1.73439 WP_000365655.1.73449 WP_000365655.1.7350 WP_000365655.1.73585 WP_000365655.1.73621 WP_000365655.1.73637 WP_000365655.1.73692 WP_000365655.1.73696 WP_000365655.1.73856 WP_000365655.1.74086 WP_000365655.1.74179 WP_000365655.1.74188 WP_000365655.1.74564 WP_000365655.1.74717 WP_000365655.1.74739 WP_000365655.1.74933 WP_000365655.1.74951 WP_000365655.1.75020 WP_000365655.1.75077 WP_000365655.1.75293 WP_000365655.1.75801 WP_000365655.1.75819 WP_000365655.1.7586 WP_000365655.1.7587 WP_000365655.1.75882 WP_000365655.1.76023 WP_000365655.1.76033 WP_000365655.1.76034 WP_000365655.1.7620 WP_000365655.1.76408 WP_000365655.1.76479 WP_000365655.1.76490 WP_000365655.1.76610 WP_000365655.1.76906 WP_000365655.1.76996 WP_000365655.1.77005 WP_000365655.1.77138 WP_000365655.1.77300 WP_000365655.1.77757 WP_000365655.1.77945 WP_000365655.1.78251 WP_000365655.1.78262 WP_000365655.1.7835 WP_000365655.1.78356 WP_000365655.1.78432 WP_000365655.1.78464 WP_000365655.1.78480 WP_000365655.1.7882 WP_000365655.1.78990 WP_000365655.1.7904 WP_000365655.1.791 WP_000365655.1.79117 WP_000365655.1.79135 WP_000365655.1.79372 WP_000365655.1.79474 WP_000365655.1.79724 WP_000365655.1.80180 WP_000365655.1.80340 WP_000365655.1.80438 WP_000365655.1.80460 WP_000365655.1.80706 WP_000365655.1.8099 WP_000365655.1.81006 WP_000365655.1.81080 WP_000365655.1.81168 WP_000365655.1.81280 WP_000365655.1.81303 WP_000365655.1.81477 WP_000365655.1.81506 WP_000365655.1.82198 WP_000365655.1.82293 WP_000365655.1.825 WP_000365655.1.82501 WP_000365655.1.82541 WP_000365655.1.82730 WP_000365655.1.82982 WP_000365655.1.83071 WP_000365655.1.83198 WP_000365655.1.8340 WP_000365655.1.83465 WP_000365655.1.83494 WP_000365655.1.83616 WP_000365655.1.8362 WP_000365655.1.83944 WP_000365655.1.84093 WP_000365655.1.84119 WP_000365655.1.84227 WP_000365655.1.84289 WP_000365655.1.84343 WP_000365655.1.84707 WP_000365655.1.84909 WP_000365655.1.85030 WP_000365655.1.852 WP_000365655.1.85296 WP_000365655.1.85605 WP_000365655.1.85914 WP_000365655.1.85946 WP_000365655.1.85966 WP_000365655.1.8625 WP_000365655.1.86366 WP_000365655.1.86497 WP_000365655.1.86500 WP_000365655.1.86532 WP_000365655.1.86535 WP_000365655.1.86635 WP_000365655.1.86651 WP_000365655.1.86972 WP_000365655.1.86986 WP_000365655.1.87011 WP_000365655.1.87030 WP_000365655.1.87033 WP_000365655.1.87062 WP_000365655.1.87251 WP_000365655.1.87307 WP_000365655.1.87380 WP_000365655.1.87395 WP_000365655.1.87412 WP_000365655.1.87546 WP_000365655.1.87807 WP_000365655.1.87880 WP_000365655.1.87882 WP_000365655.1.88071 WP_000365655.1.88209 WP_000365655.1.88262 WP_000365655.1.88296 WP_000365655.1.88344 WP_000365655.1.88345 WP_000365655.1.88429 WP_000365655.1.8861 WP_000365655.1.887 WP_000365655.1.88701 WP_000365655.1.88744 WP_000365655.1.88855 WP_000365655.1.89132 WP_000365655.1.89248 WP_000365655.1.89303 WP_000365655.1.89336 WP_000365655.1.89477 WP_000365655.1.89574 WP_000365655.1.89608 WP_000365655.1.89838 WP_000365655.1.89890 WP_000365655.1.90019 WP_000365655.1.90068 WP_000365655.1.90074 WP_000365655.1.90129 WP_000365655.1.90214 WP_000365655.1.90411 WP_000365655.1.90530 WP_000365655.1.90664 WP_000365655.1.90666 WP_000365655.1.90749 WP_000365655.1.90867 WP_000365655.1.90941 WP_000365655.1.9099 WP_000365655.1.91002 WP_000365655.1.91223 WP_000365655.1.91270 WP_000365655.1.91285 WP_000365655.1.9136 WP_000365655.1.91673 WP_000365655.1.91731 WP_000365655.1.92126 WP_000365655.1.92152 WP_000365655.1.92184 WP_000365655.1.92219 WP_000365655.1.92320 WP_000365655.1.92547 WP_000365655.1.92590 WP_000365655.1.92647 WP_000365655.1.92684 WP_000365655.1.92762 WP_000365655.1.92811 WP_000365655.1.9295 WP_000365655.1.93080 WP_000365655.1.933 WP_000365655.1.93303 WP_000365655.1.93323 WP_000365655.1.93394 WP_000365655.1.93537 WP_000365655.1.93734 WP_000365655.1.93793 WP_000365655.1.93825 WP_000365655.1.9386 WP_000365655.1.93884 WP_000365655.1.94109 WP_000365655.1.94194 WP_000365655.1.94346 WP_000365655.1.94370 WP_000365655.1.94457 WP_000365655.1.94532 WP_000365655.1.94803 WP_000365655.1.94973 WP_000365655.1.95328 WP_000365655.1.95394 WP_000365655.1.95658 WP_000365655.1.95950 WP_000365655.1.96026 WP_000365655.1.96087 WP_000365655.1.96116 WP_000365655.1.96137 WP_000365655.1.96406 WP_000365655.1.96485 WP_000365655.1.96768 WP_000365655.1.96868 WP_000365655.1.96943 WP_000365655.1.96986 WP_000365655.1.9711 WP_000365655.1.97166 WP_000365655.1.9741 WP_000365655.1.97621 WP_000365655.1.97836 WP_000365655.1.97838 WP_000365655.1.97850 WP_000365655.1.98063 WP_000365655.1.98185 WP_000365655.1.9822 WP_000365655.1.98264 WP_000365655.1.98346 WP_000365655.1.98370 WP_000365655.1.98584 WP_000365655.1.98638 WP_000365655.1.98766 WP_000365655.1.98773 WP_000365655.1.98832 WP_000365655.1.98979 WP_000365655.1.99017 WP_000365655.1.99019 WP_000365655.1.99056 WP_000365655.1.99241 WP_000365655.1.99286 WP_000365655.1.99447 WP_000365655.1.99728 WP_000365655.1.99946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]