SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76788602|ref|YP_329218.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76788602|ref|YP_329218.1|
Domain Number - Region: 93-124
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0235
Family F1F0 ATP synthase subunit B, membrane domain 0.0075
Further Details:      
 
Domain Number - Region: 16-69
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0247
Family DNA-binding N-terminal domain of transcription activators 0.0067
Further Details:      
 
Domain Number - Region: 166-234
Classification Level Classification E-value
Superfamily FliG 0.0549
Family FliG 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76788602|ref|YP_329218.1|
Sequence length 256
Comment cell division protein DivIVA [Streptococcus agalactiae A909]
Sequence
MPLTALEIKDKTFSSKFRGYSEEEVNEFLEIVVDDYEDLIRRNREQEQYIKDLEEKIAYF
NEMKESLSQSVILAQETAERVKISAQDEASNLMGKATFDAQHLIDEAKLKANQILRDATD
DAKRVAIETEDLKRQSRVFHQRLLSELEGQLKLANSSAWEELLKPTAIYLQNSDASFKEV
VEKVLDEDDALPVVDDTESFDATRQFSPDEMEELQRRVEESNKQLEESGLLDTNNFQMEE
PINLGETQTFKLNIED
Download sequence
Identical sequences A0A1F0CB90 A0A1J7V2I5 E7S5J7 Q8E178 Q8E6N2 S8G3K3 S8G8C6 S8GSV8 S8HBM2 S8NR69 S8NRW5 S8QH59 S9BEU3 S9C9P7 S9D4J8 S9MHA8 X5KFI1
gi|76788602|ref|YP_329218.1| APC85679 gi|25010600|ref|NP_734995.1| NP_687514.1.71890 WP_001131467.1.100037 WP_001131467.1.100093 WP_001131467.1.100254 WP_001131467.1.100267 WP_001131467.1.10029 WP_001131467.1.100296 WP_001131467.1.100367 WP_001131467.1.100520 WP_001131467.1.100641 WP_001131467.1.100766 WP_001131467.1.100913 WP_001131467.1.101195 WP_001131467.1.101208 WP_001131467.1.101222 WP_001131467.1.101267 WP_001131467.1.101283 WP_001131467.1.101296 WP_001131467.1.101319 WP_001131467.1.101830 WP_001131467.1.101853 WP_001131467.1.101864 WP_001131467.1.101938 WP_001131467.1.101956 WP_001131467.1.102056 WP_001131467.1.10371 WP_001131467.1.10618 WP_001131467.1.10620 WP_001131467.1.10645 WP_001131467.1.1067 WP_001131467.1.10676 WP_001131467.1.10723 WP_001131467.1.10924 WP_001131467.1.11343 WP_001131467.1.11465 WP_001131467.1.1163 WP_001131467.1.11756 WP_001131467.1.11941 WP_001131467.1.12102 WP_001131467.1.12166 WP_001131467.1.12249 WP_001131467.1.12331 WP_001131467.1.12363 WP_001131467.1.1251 WP_001131467.1.12619 WP_001131467.1.12688 WP_001131467.1.12755 WP_001131467.1.1293 WP_001131467.1.12978 WP_001131467.1.13064 WP_001131467.1.13167 WP_001131467.1.13285 WP_001131467.1.13493 WP_001131467.1.13553 WP_001131467.1.13658 WP_001131467.1.13737 WP_001131467.1.13885 WP_001131467.1.1402 WP_001131467.1.14275 WP_001131467.1.14324 WP_001131467.1.1437 WP_001131467.1.14429 WP_001131467.1.14563 WP_001131467.1.14738 WP_001131467.1.14953 WP_001131467.1.14960 WP_001131467.1.15199 WP_001131467.1.15417 WP_001131467.1.15526 WP_001131467.1.15556 WP_001131467.1.15760 WP_001131467.1.16134 WP_001131467.1.16165 WP_001131467.1.1633 WP_001131467.1.16342 WP_001131467.1.16528 WP_001131467.1.16535 WP_001131467.1.16595 WP_001131467.1.16706 WP_001131467.1.1681 WP_001131467.1.1696 WP_001131467.1.16976 WP_001131467.1.17056 WP_001131467.1.17243 WP_001131467.1.17339 WP_001131467.1.17489 WP_001131467.1.1760 WP_001131467.1.17707 WP_001131467.1.17709 WP_001131467.1.17815 WP_001131467.1.18003 WP_001131467.1.18047 WP_001131467.1.18362 WP_001131467.1.18425 WP_001131467.1.18450 WP_001131467.1.18747 WP_001131467.1.1882 WP_001131467.1.18829 WP_001131467.1.18841 WP_001131467.1.18933 WP_001131467.1.19073 WP_001131467.1.19086 WP_001131467.1.19604 WP_001131467.1.19892 WP_001131467.1.19950 WP_001131467.1.20123 WP_001131467.1.20188 WP_001131467.1.20258 WP_001131467.1.20326 WP_001131467.1.20350 WP_001131467.1.20435 WP_001131467.1.20458 WP_001131467.1.20511 WP_001131467.1.20726 WP_001131467.1.20791 WP_001131467.1.20847 WP_001131467.1.21087 WP_001131467.1.21280 WP_001131467.1.21522 WP_001131467.1.21525 WP_001131467.1.21669 WP_001131467.1.21722 WP_001131467.1.21779 WP_001131467.1.22004 WP_001131467.1.22076 WP_001131467.1.22087 WP_001131467.1.22139 WP_001131467.1.222 WP_001131467.1.22247 WP_001131467.1.22749 WP_001131467.1.22801 WP_001131467.1.23126 WP_001131467.1.23380 WP_001131467.1.23384 WP_001131467.1.24162 WP_001131467.1.24296 WP_001131467.1.24441 WP_001131467.1.24475 WP_001131467.1.24559 WP_001131467.1.24827 WP_001131467.1.24845 WP_001131467.1.25182 WP_001131467.1.25303 WP_001131467.1.2555 WP_001131467.1.25647 WP_001131467.1.25670 WP_001131467.1.25781 WP_001131467.1.25949 WP_001131467.1.25973 WP_001131467.1.25998 WP_001131467.1.26029 WP_001131467.1.26046 WP_001131467.1.26056 WP_001131467.1.26153 WP_001131467.1.26258 WP_001131467.1.26300 WP_001131467.1.26357 WP_001131467.1.26386 WP_001131467.1.2651 WP_001131467.1.26786 WP_001131467.1.26827 WP_001131467.1.27024 WP_001131467.1.27184 WP_001131467.1.27318 WP_001131467.1.27325 WP_001131467.1.2754 WP_001131467.1.27583 WP_001131467.1.27751 WP_001131467.1.2781 WP_001131467.1.27880 WP_001131467.1.27958 WP_001131467.1.28021 WP_001131467.1.28197 WP_001131467.1.28342 WP_001131467.1.2844 WP_001131467.1.28613 WP_001131467.1.28630 WP_001131467.1.28738 WP_001131467.1.28991 WP_001131467.1.29020 WP_001131467.1.29163 WP_001131467.1.29238 WP_001131467.1.29352 WP_001131467.1.29719 WP_001131467.1.29771 WP_001131467.1.29888 WP_001131467.1.30062 WP_001131467.1.30200 WP_001131467.1.30252 WP_001131467.1.3028 WP_001131467.1.30321 WP_001131467.1.30388 WP_001131467.1.3052 WP_001131467.1.30603 WP_001131467.1.30703 WP_001131467.1.30710 WP_001131467.1.3074 WP_001131467.1.30831 WP_001131467.1.30974 WP_001131467.1.31109 WP_001131467.1.3112 WP_001131467.1.31250 WP_001131467.1.3166 WP_001131467.1.31888 WP_001131467.1.31894 WP_001131467.1.31904 WP_001131467.1.32053 WP_001131467.1.32511 WP_001131467.1.32520 WP_001131467.1.32603 WP_001131467.1.32728 WP_001131467.1.32745 WP_001131467.1.32818 WP_001131467.1.33105 WP_001131467.1.33723 WP_001131467.1.34174 WP_001131467.1.34227 WP_001131467.1.34276 WP_001131467.1.34475 WP_001131467.1.34828 WP_001131467.1.34896 WP_001131467.1.34906 WP_001131467.1.35216 WP_001131467.1.35428 WP_001131467.1.3543 WP_001131467.1.35443 WP_001131467.1.35451 WP_001131467.1.35908 WP_001131467.1.36095 WP_001131467.1.36202 WP_001131467.1.36258 WP_001131467.1.36408 WP_001131467.1.36594 WP_001131467.1.36710 WP_001131467.1.36726 WP_001131467.1.36776 WP_001131467.1.36800 WP_001131467.1.36878 WP_001131467.1.3691 WP_001131467.1.37018 WP_001131467.1.37098 WP_001131467.1.37124 WP_001131467.1.37523 WP_001131467.1.37547 WP_001131467.1.37570 WP_001131467.1.37692 WP_001131467.1.3814 WP_001131467.1.3845 WP_001131467.1.38578 WP_001131467.1.38699 WP_001131467.1.3880 WP_001131467.1.38842 WP_001131467.1.38910 WP_001131467.1.3927 WP_001131467.1.39284 WP_001131467.1.3930 WP_001131467.1.3937 WP_001131467.1.39386 WP_001131467.1.39495 WP_001131467.1.3963 WP_001131467.1.39656 WP_001131467.1.39673 WP_001131467.1.40015 WP_001131467.1.40203 WP_001131467.1.40241 WP_001131467.1.40359 WP_001131467.1.40538 WP_001131467.1.40650 WP_001131467.1.40694 WP_001131467.1.40765 WP_001131467.1.40774 WP_001131467.1.41269 WP_001131467.1.41329 WP_001131467.1.41338 WP_001131467.1.41399 WP_001131467.1.41646 WP_001131467.1.41663 WP_001131467.1.41785 WP_001131467.1.41865 WP_001131467.1.42144 WP_001131467.1.4215 WP_001131467.1.42225 WP_001131467.1.42271 WP_001131467.1.42540 WP_001131467.1.42686 WP_001131467.1.42844 WP_001131467.1.43138 WP_001131467.1.43199 WP_001131467.1.4323 WP_001131467.1.44371 WP_001131467.1.44374 WP_001131467.1.44712 WP_001131467.1.44727 WP_001131467.1.44746 WP_001131467.1.44777 WP_001131467.1.44957 WP_001131467.1.45 WP_001131467.1.45058 WP_001131467.1.45103 WP_001131467.1.45150 WP_001131467.1.45180 WP_001131467.1.45540 WP_001131467.1.45553 WP_001131467.1.45782 WP_001131467.1.45790 WP_001131467.1.45896 WP_001131467.1.45976 WP_001131467.1.46043 WP_001131467.1.46116 WP_001131467.1.46747 WP_001131467.1.46992 WP_001131467.1.47044 WP_001131467.1.47485 WP_001131467.1.47497 WP_001131467.1.47584 WP_001131467.1.47608 WP_001131467.1.48052 WP_001131467.1.48120 WP_001131467.1.48239 WP_001131467.1.48416 WP_001131467.1.48502 WP_001131467.1.48518 WP_001131467.1.48557 WP_001131467.1.49082 WP_001131467.1.49278 WP_001131467.1.49371 WP_001131467.1.49421 WP_001131467.1.49423 WP_001131467.1.49508 WP_001131467.1.49888 WP_001131467.1.50082 WP_001131467.1.50186 WP_001131467.1.5019 WP_001131467.1.50326 WP_001131467.1.50420 WP_001131467.1.5055 WP_001131467.1.50552 WP_001131467.1.50639 WP_001131467.1.50776 WP_001131467.1.50874 WP_001131467.1.51102 WP_001131467.1.51114 WP_001131467.1.51125 WP_001131467.1.5137 WP_001131467.1.51547 WP_001131467.1.51570 WP_001131467.1.51780 WP_001131467.1.52139 WP_001131467.1.52273 WP_001131467.1.52401 WP_001131467.1.52470 WP_001131467.1.52514 WP_001131467.1.52634 WP_001131467.1.52729 WP_001131467.1.52826 WP_001131467.1.52916 WP_001131467.1.52981 WP_001131467.1.53013 WP_001131467.1.53087 WP_001131467.1.53549 WP_001131467.1.54107 WP_001131467.1.54156 WP_001131467.1.54228 WP_001131467.1.5437 WP_001131467.1.54416 WP_001131467.1.54423 WP_001131467.1.54487 WP_001131467.1.5451 WP_001131467.1.54629 WP_001131467.1.54752 WP_001131467.1.54757 WP_001131467.1.54818 WP_001131467.1.54821 WP_001131467.1.54844 WP_001131467.1.54896 WP_001131467.1.54978 WP_001131467.1.55451 WP_001131467.1.55542 WP_001131467.1.55655 WP_001131467.1.55673 WP_001131467.1.55753 WP_001131467.1.55775 WP_001131467.1.55921 WP_001131467.1.56011 WP_001131467.1.56043 WP_001131467.1.56192 WP_001131467.1.56208 WP_001131467.1.564 WP_001131467.1.56404 WP_001131467.1.56602 WP_001131467.1.56930 WP_001131467.1.57174 WP_001131467.1.57262 WP_001131467.1.57336 WP_001131467.1.57347 WP_001131467.1.57407 WP_001131467.1.57557 WP_001131467.1.57586 WP_001131467.1.57721 WP_001131467.1.57756 WP_001131467.1.57900 WP_001131467.1.58075 WP_001131467.1.58119 WP_001131467.1.58208 WP_001131467.1.58254 WP_001131467.1.58255 WP_001131467.1.58297 WP_001131467.1.58313 WP_001131467.1.58520 WP_001131467.1.58988 WP_001131467.1.59040 WP_001131467.1.59057 WP_001131467.1.59196 WP_001131467.1.59460 WP_001131467.1.59565 WP_001131467.1.5977 WP_001131467.1.59783 WP_001131467.1.5999 WP_001131467.1.60058 WP_001131467.1.60093 WP_001131467.1.60159 WP_001131467.1.60290 WP_001131467.1.60593 WP_001131467.1.60702 WP_001131467.1.6096 WP_001131467.1.61032 WP_001131467.1.61176 WP_001131467.1.61267 WP_001131467.1.6131 WP_001131467.1.61433 WP_001131467.1.61458 WP_001131467.1.61554 WP_001131467.1.61581 WP_001131467.1.61676 WP_001131467.1.61790 WP_001131467.1.61844 WP_001131467.1.62057 WP_001131467.1.62267 WP_001131467.1.62276 WP_001131467.1.62362 WP_001131467.1.62758 WP_001131467.1.63086 WP_001131467.1.63345 WP_001131467.1.63363 WP_001131467.1.63367 WP_001131467.1.63394 WP_001131467.1.63482 WP_001131467.1.63508 WP_001131467.1.6360 WP_001131467.1.63764 WP_001131467.1.63980 WP_001131467.1.63991 WP_001131467.1.64182 WP_001131467.1.64206 WP_001131467.1.64256 WP_001131467.1.64297 WP_001131467.1.64352 WP_001131467.1.64459 WP_001131467.1.64468 WP_001131467.1.64651 WP_001131467.1.64713 WP_001131467.1.64967 WP_001131467.1.64975 WP_001131467.1.65010 WP_001131467.1.65036 WP_001131467.1.65059 WP_001131467.1.6512 WP_001131467.1.65139 WP_001131467.1.65195 WP_001131467.1.65297 WP_001131467.1.65323 WP_001131467.1.65427 WP_001131467.1.6564 WP_001131467.1.65668 WP_001131467.1.66063 WP_001131467.1.66242 WP_001131467.1.66680 WP_001131467.1.66732 WP_001131467.1.67002 WP_001131467.1.67008 WP_001131467.1.67162 WP_001131467.1.67277 WP_001131467.1.67318 WP_001131467.1.67444 WP_001131467.1.67476 WP_001131467.1.67859 WP_001131467.1.68143 WP_001131467.1.68290 WP_001131467.1.6840 WP_001131467.1.68413 WP_001131467.1.68443 WP_001131467.1.68587 WP_001131467.1.68641 WP_001131467.1.68732 WP_001131467.1.68788 WP_001131467.1.68827 WP_001131467.1.68867 WP_001131467.1.68890 WP_001131467.1.68905 WP_001131467.1.69023 WP_001131467.1.69034 WP_001131467.1.69077 WP_001131467.1.69101 WP_001131467.1.69132 WP_001131467.1.69163 WP_001131467.1.69214 WP_001131467.1.69705 WP_001131467.1.6986 WP_001131467.1.7017 WP_001131467.1.70219 WP_001131467.1.70242 WP_001131467.1.70276 WP_001131467.1.70286 WP_001131467.1.70391 WP_001131467.1.70397 WP_001131467.1.70562 WP_001131467.1.70742 WP_001131467.1.70879 WP_001131467.1.70897 WP_001131467.1.70932 WP_001131467.1.71044 WP_001131467.1.71237 WP_001131467.1.71554 WP_001131467.1.71606 WP_001131467.1.71709 WP_001131467.1.7191 WP_001131467.1.72284 WP_001131467.1.7234 WP_001131467.1.72381 WP_001131467.1.72464 WP_001131467.1.72821 WP_001131467.1.73082 WP_001131467.1.73137 WP_001131467.1.73184 WP_001131467.1.73417 WP_001131467.1.73421 WP_001131467.1.73439 WP_001131467.1.73449 WP_001131467.1.7350 WP_001131467.1.73585 WP_001131467.1.73621 WP_001131467.1.73625 WP_001131467.1.73637 WP_001131467.1.73692 WP_001131467.1.73696 WP_001131467.1.74086 WP_001131467.1.74188 WP_001131467.1.74375 WP_001131467.1.74564 WP_001131467.1.74717 WP_001131467.1.74739 WP_001131467.1.74933 WP_001131467.1.74951 WP_001131467.1.75020 WP_001131467.1.75077 WP_001131467.1.75293 WP_001131467.1.7530 WP_001131467.1.75801 WP_001131467.1.7586 WP_001131467.1.7587 WP_001131467.1.75882 WP_001131467.1.76023 WP_001131467.1.76033 WP_001131467.1.76034 WP_001131467.1.7620 WP_001131467.1.76222 WP_001131467.1.76334 WP_001131467.1.76408 WP_001131467.1.76479 WP_001131467.1.76490 WP_001131467.1.76610 WP_001131467.1.76747 WP_001131467.1.76906 WP_001131467.1.76996 WP_001131467.1.77005 WP_001131467.1.77493 WP_001131467.1.77757 WP_001131467.1.77945 WP_001131467.1.78006 WP_001131467.1.78292 WP_001131467.1.78432 WP_001131467.1.78464 WP_001131467.1.78552 WP_001131467.1.7882 WP_001131467.1.78990 WP_001131467.1.78994 WP_001131467.1.7904 WP_001131467.1.791 WP_001131467.1.79117 WP_001131467.1.79135 WP_001131467.1.79372 WP_001131467.1.79474 WP_001131467.1.79724 WP_001131467.1.80046 WP_001131467.1.80180 WP_001131467.1.80340 WP_001131467.1.80460 WP_001131467.1.80706 WP_001131467.1.80895 WP_001131467.1.81115 WP_001131467.1.81168 WP_001131467.1.81280 WP_001131467.1.81303 WP_001131467.1.81477 WP_001131467.1.81506 WP_001131467.1.82198 WP_001131467.1.82293 WP_001131467.1.82501 WP_001131467.1.82730 WP_001131467.1.82982 WP_001131467.1.83071 WP_001131467.1.83198 WP_001131467.1.8340 WP_001131467.1.83429 WP_001131467.1.83465 WP_001131467.1.83494 WP_001131467.1.83616 WP_001131467.1.8362 WP_001131467.1.83723 WP_001131467.1.83944 WP_001131467.1.84093 WP_001131467.1.84119 WP_001131467.1.84227 WP_001131467.1.84273 WP_001131467.1.84289 WP_001131467.1.84343 WP_001131467.1.84909 WP_001131467.1.85015 WP_001131467.1.85030 WP_001131467.1.85179 WP_001131467.1.852 WP_001131467.1.85296 WP_001131467.1.85605 WP_001131467.1.8568 WP_001131467.1.85914 WP_001131467.1.85966 WP_001131467.1.8625 WP_001131467.1.86400 WP_001131467.1.86511 WP_001131467.1.86532 WP_001131467.1.86535 WP_001131467.1.86635 WP_001131467.1.86651 WP_001131467.1.86986 WP_001131467.1.87011 WP_001131467.1.87033 WP_001131467.1.87062 WP_001131467.1.87307 WP_001131467.1.87395 WP_001131467.1.87412 WP_001131467.1.87546 WP_001131467.1.87697 WP_001131467.1.87807 WP_001131467.1.87810 WP_001131467.1.87880 WP_001131467.1.87882 WP_001131467.1.88071 WP_001131467.1.88248 WP_001131467.1.88262 WP_001131467.1.88296 WP_001131467.1.88344 WP_001131467.1.88357 WP_001131467.1.8861 WP_001131467.1.887 WP_001131467.1.88701 WP_001131467.1.88744 WP_001131467.1.88855 WP_001131467.1.89132 WP_001131467.1.89248 WP_001131467.1.89303 WP_001131467.1.89336 WP_001131467.1.89477 WP_001131467.1.89574 WP_001131467.1.89608 WP_001131467.1.90019 WP_001131467.1.90068 WP_001131467.1.90129 WP_001131467.1.90136 WP_001131467.1.90214 WP_001131467.1.90411 WP_001131467.1.90530 WP_001131467.1.90664 WP_001131467.1.90666 WP_001131467.1.90749 WP_001131467.1.90867 WP_001131467.1.90941 WP_001131467.1.91002 WP_001131467.1.91223 WP_001131467.1.9125 WP_001131467.1.91270 WP_001131467.1.91285 WP_001131467.1.9136 WP_001131467.1.91673 WP_001131467.1.91731 WP_001131467.1.92184 WP_001131467.1.92219 WP_001131467.1.92320 WP_001131467.1.92547 WP_001131467.1.92590 WP_001131467.1.92647 WP_001131467.1.92762 WP_001131467.1.92811 WP_001131467.1.9295 WP_001131467.1.93080 WP_001131467.1.933 WP_001131467.1.93303 WP_001131467.1.93323 WP_001131467.1.93358 WP_001131467.1.93394 WP_001131467.1.93537 WP_001131467.1.93607 WP_001131467.1.93793 WP_001131467.1.93825 WP_001131467.1.9386 WP_001131467.1.93881 WP_001131467.1.93884 WP_001131467.1.94194 WP_001131467.1.94310 WP_001131467.1.94346 WP_001131467.1.94370 WP_001131467.1.94457 WP_001131467.1.94532 WP_001131467.1.94803 WP_001131467.1.94868 WP_001131467.1.94973 WP_001131467.1.95328 WP_001131467.1.95394 WP_001131467.1.95658 WP_001131467.1.95950 WP_001131467.1.95993 WP_001131467.1.96026 WP_001131467.1.96087 WP_001131467.1.96116 WP_001131467.1.96137 WP_001131467.1.96406 WP_001131467.1.96475 WP_001131467.1.96868 WP_001131467.1.96943 WP_001131467.1.96986 WP_001131467.1.9711 WP_001131467.1.97166 WP_001131467.1.9741 WP_001131467.1.97621 WP_001131467.1.97630 WP_001131467.1.97838 WP_001131467.1.97850 WP_001131467.1.98185 WP_001131467.1.9822 WP_001131467.1.98346 WP_001131467.1.98370 WP_001131467.1.98584 WP_001131467.1.98638 WP_001131467.1.98766 WP_001131467.1.98773 WP_001131467.1.98832 WP_001131467.1.98979 WP_001131467.1.99017 WP_001131467.1.99019 WP_001131467.1.99056 WP_001131467.1.99149 WP_001131467.1.99241 WP_001131467.1.99286 WP_001131467.1.99447 gi|406709017|ref|YP_006763743.1| gi|22536663|ref|NP_687514.1| 205921.SAK_0586 208435.SAG0484 211110.gbs0531 gi|512538722|ref|YP_008084226.1| gi|512697937|ref|YP_008117222.1| gi|512544217|ref|YP_008086330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]