SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76788619|ref|YP_330636.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76788619|ref|YP_330636.1|
Domain Number 1 Region: 117-295,419-578
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.02e-104
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000102
Further Details:      
 
Domain Number 2 Region: 292-414
Classification Level Classification E-value
Superfamily GAD domain-like 1.14e-37
Family GAD domain 0.00066
Further Details:      
 
Domain Number 3 Region: 2-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.24e-29
Family Anticodon-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76788619|ref|YP_330636.1|
Sequence length 583
Comment aspartyl-tRNA synthetase [Streptococcus agalactiae A909]
Sequence
MKRSMYAGRVRSEHIGTSITLKGWVGRRRDLGGLIFIDLRDREGIMQLVINPEEVSASVM
ATAESLRSEFVIEVSGVVTAREQANDNLPTGEVELKVQELSVLNTSKTTPFEIKDGIEAN
DDTRMRYRYLDLRRPEMLENFKLRAKVTHSIRNYLDNLEFIDVETPMLTKSTPEGARDYL
VPSRVNQGHFYALPQSPQITKQLLMNAGFDRYYQIVKCFRDEDLRGDRQPEFTQVDLETS
FLSDQEIQDIVEGMIAKVMKDTKGLEVSLPFPRMAYDDAMNNYGSDKPDTRFDMLLQDLT
EVVKEVDFKVFSEASVVKAIVVKNKADKYSRKNIDKLTEIAKQYGAKGLAWLKYADNTIS
GPVAKFLTAIEDRLTEALQLENNDLILFVADSLEVANETLGALRTRIAKELELIDYSKFN
FLWIVDWPMFEWSEEEGRYMSAHHPFTLPTAETAHELEGDLAKVRAVAYDIVLNGYELGG
GSLRINQKDTQERMFKALGFSAESAQEQFGFLLEAMDYGFPPHGGLAIGLDRFVMLLAGK
DNIREVIAFPKNNKASDPMTQAPSLVSEQQLEELSLTVESYEN
Download sequence
Identical sequences Q3JYL7
gi|76788619|ref|YP_330636.1| 205921.SAK_2046 WP_000830936.1.100766 WP_000830936.1.12166 WP_000830936.1.12978 WP_000830936.1.20188 WP_000830936.1.22004 WP_000830936.1.23380 WP_000830936.1.30710 WP_000830936.1.32728 WP_000830936.1.34906 WP_000830936.1.36878 WP_000830936.1.3963 WP_000830936.1.45150 WP_000830936.1.45976 WP_000830936.1.47485 WP_000830936.1.48239 WP_000830936.1.56404 WP_000830936.1.57721 WP_000830936.1.59565 WP_000830936.1.5977 WP_000830936.1.61790 WP_000830936.1.63764 WP_000830936.1.64713 WP_000830936.1.67008 WP_000830936.1.69023 WP_000830936.1.69101 WP_000830936.1.70397 WP_000830936.1.75293 WP_000830936.1.79135 WP_000830936.1.81168 WP_000830936.1.81506 WP_000830936.1.82501 WP_000830936.1.83616 WP_000830936.1.84119 WP_000830936.1.87033 WP_000830936.1.88296 WP_000830936.1.89303 WP_000830936.1.90411 WP_000830936.1.90530 WP_000830936.1.90666 WP_000830936.1.90941 WP_000830936.1.933 WP_000830936.1.94370 gi|406710417|ref|YP_006765143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]