SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76788666|ref|YP_330369.1| from Streptococcus agalactiae A909

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76788666|ref|YP_330369.1|
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.06e-23
Family DNA-binding N-terminal domain of transcription activators 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|76788666|ref|YP_330369.1|
Domain Number - Region: 187-232
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000837
Family Di-heme elbow motif 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76788666|ref|YP_330369.1|
Sequence length 241
Comment MerR family transcriptional regulator [Streptococcus agalactiae A909]
Sequence
MSEKYSTGDLAKEAGVTVRTVQYYDKRGILSPSELSEGGRRVYSIADLEKLRQIIYLRDL
DFSIDNIKNLFTEDNASQILELFLQVQIRELRLSIDSKKDKLDKAVNLLKTVEKQDSKTL
GYLSDIVLMEENKRKWGKLQKSIVLQVIMIIMVYITLIMAAVSLNQRWLMWIAVTVFLIA
MNGMVWYFKQQVVYLCPNCHQTFTPTYQAFNLAKHTPKTRKVFCPHCHQKSHCIELAREE
R
Download sequence
Identical sequences A0A0E1EJK3
gi|512539964|ref|YP_008085468.1| gi|406710143|ref|YP_006764869.1| WP_001292011.1.10029 WP_001292011.1.100367 WP_001292011.1.100766 WP_001292011.1.101222 WP_001292011.1.101267 WP_001292011.1.101296 WP_001292011.1.101830 WP_001292011.1.101853 WP_001292011.1.101864 WP_001292011.1.10371 WP_001292011.1.10723 WP_001292011.1.10924 WP_001292011.1.11465 WP_001292011.1.12166 WP_001292011.1.1251 WP_001292011.1.12619 WP_001292011.1.12688 WP_001292011.1.12755 WP_001292011.1.12978 WP_001292011.1.13064 WP_001292011.1.13285 WP_001292011.1.14275 WP_001292011.1.14324 WP_001292011.1.1437 WP_001292011.1.14563 WP_001292011.1.14738 WP_001292011.1.14953 WP_001292011.1.14960 WP_001292011.1.15417 WP_001292011.1.15526 WP_001292011.1.15556 WP_001292011.1.16134 WP_001292011.1.16165 WP_001292011.1.16342 WP_001292011.1.16595 WP_001292011.1.17339 WP_001292011.1.1760 WP_001292011.1.1775 WP_001292011.1.18425 WP_001292011.1.18450 WP_001292011.1.18829 WP_001292011.1.18841 WP_001292011.1.18933 WP_001292011.1.19892 WP_001292011.1.20123 WP_001292011.1.20188 WP_001292011.1.20326 WP_001292011.1.20791 WP_001292011.1.20847 WP_001292011.1.21522 WP_001292011.1.21525 WP_001292011.1.21722 WP_001292011.1.22004 WP_001292011.1.22139 WP_001292011.1.23380 WP_001292011.1.23384 WP_001292011.1.24441 WP_001292011.1.24475 WP_001292011.1.24845 WP_001292011.1.25781 WP_001292011.1.26029 WP_001292011.1.26056 WP_001292011.1.2651 WP_001292011.1.26791 WP_001292011.1.26827 WP_001292011.1.27024 WP_001292011.1.2754 WP_001292011.1.27583 WP_001292011.1.27880 WP_001292011.1.27958 WP_001292011.1.28021 WP_001292011.1.29163 WP_001292011.1.29238 WP_001292011.1.29352 WP_001292011.1.29719 WP_001292011.1.29888 WP_001292011.1.30062 WP_001292011.1.30252 WP_001292011.1.30703 WP_001292011.1.30710 WP_001292011.1.3074 WP_001292011.1.3112 WP_001292011.1.3166 WP_001292011.1.31888 WP_001292011.1.32520 WP_001292011.1.32728 WP_001292011.1.32818 WP_001292011.1.33723 WP_001292011.1.34227 WP_001292011.1.34276 WP_001292011.1.34467 WP_001292011.1.34475 WP_001292011.1.34896 WP_001292011.1.34906 WP_001292011.1.35428 WP_001292011.1.36095 WP_001292011.1.36408 WP_001292011.1.36726 WP_001292011.1.36878 WP_001292011.1.36977 WP_001292011.1.37523 WP_001292011.1.38578 WP_001292011.1.38699 WP_001292011.1.3880 WP_001292011.1.38842 WP_001292011.1.38910 WP_001292011.1.3930 WP_001292011.1.39386 WP_001292011.1.3963 WP_001292011.1.40015 WP_001292011.1.40359 WP_001292011.1.41399 WP_001292011.1.41663 WP_001292011.1.41785 WP_001292011.1.4215 WP_001292011.1.42844 WP_001292011.1.43199 WP_001292011.1.44371 WP_001292011.1.44374 WP_001292011.1.44712 WP_001292011.1.44727 WP_001292011.1.44746 WP_001292011.1.45 WP_001292011.1.45103 WP_001292011.1.45150 WP_001292011.1.45540 WP_001292011.1.45896 WP_001292011.1.45976 WP_001292011.1.46116 WP_001292011.1.46992 WP_001292011.1.47485 WP_001292011.1.48052 WP_001292011.1.48239 WP_001292011.1.49421 WP_001292011.1.50326 WP_001292011.1.5055 WP_001292011.1.50639 WP_001292011.1.50874 WP_001292011.1.51114 WP_001292011.1.51780 WP_001292011.1.52273 WP_001292011.1.52401 WP_001292011.1.52470 WP_001292011.1.52826 WP_001292011.1.52916 WP_001292011.1.52981 WP_001292011.1.54416 WP_001292011.1.54423 WP_001292011.1.54818 WP_001292011.1.55451 WP_001292011.1.55753 WP_001292011.1.564 WP_001292011.1.56404 WP_001292011.1.56602 WP_001292011.1.56930 WP_001292011.1.57174 WP_001292011.1.57407 WP_001292011.1.57557 WP_001292011.1.57586 WP_001292011.1.57721 WP_001292011.1.57900 WP_001292011.1.58075 WP_001292011.1.59565 WP_001292011.1.5977 WP_001292011.1.60159 WP_001292011.1.60593 WP_001292011.1.61267 WP_001292011.1.61458 WP_001292011.1.61676 WP_001292011.1.61790 WP_001292011.1.62057 WP_001292011.1.62362 WP_001292011.1.62758 WP_001292011.1.6321 WP_001292011.1.63363 WP_001292011.1.63482 WP_001292011.1.6360 WP_001292011.1.63764 WP_001292011.1.63980 WP_001292011.1.64182 WP_001292011.1.64206 WP_001292011.1.64297 WP_001292011.1.64459 WP_001292011.1.64468 WP_001292011.1.64713 WP_001292011.1.64975 WP_001292011.1.65195 WP_001292011.1.65323 WP_001292011.1.6564 WP_001292011.1.66242 WP_001292011.1.67008 WP_001292011.1.67162 WP_001292011.1.67318 WP_001292011.1.67444 WP_001292011.1.67476 WP_001292011.1.67759 WP_001292011.1.68290 WP_001292011.1.6840 WP_001292011.1.68443 WP_001292011.1.68587 WP_001292011.1.68732 WP_001292011.1.68788 WP_001292011.1.68827 WP_001292011.1.69023 WP_001292011.1.69077 WP_001292011.1.69101 WP_001292011.1.69132 WP_001292011.1.70219 WP_001292011.1.70276 WP_001292011.1.70286 WP_001292011.1.70397 WP_001292011.1.71044 WP_001292011.1.71237 WP_001292011.1.71554 WP_001292011.1.7191 WP_001292011.1.7234 WP_001292011.1.72381 WP_001292011.1.72464 WP_001292011.1.73082 WP_001292011.1.73137 WP_001292011.1.73417 WP_001292011.1.73637 WP_001292011.1.73696 WP_001292011.1.74188 WP_001292011.1.74951 WP_001292011.1.75020 WP_001292011.1.75077 WP_001292011.1.75293 WP_001292011.1.7586 WP_001292011.1.76034 WP_001292011.1.7620 WP_001292011.1.76408 WP_001292011.1.76610 WP_001292011.1.76906 WP_001292011.1.76996 WP_001292011.1.77005 WP_001292011.1.77945 WP_001292011.1.78251 WP_001292011.1.78432 WP_001292011.1.78464 WP_001292011.1.7882 WP_001292011.1.79135 WP_001292011.1.79474 WP_001292011.1.79724 WP_001292011.1.80180 WP_001292011.1.80706 WP_001292011.1.81115 WP_001292011.1.81168 WP_001292011.1.81303 WP_001292011.1.81506 WP_001292011.1.82293 WP_001292011.1.82501 WP_001292011.1.82730 WP_001292011.1.8340 WP_001292011.1.83616 WP_001292011.1.8362 WP_001292011.1.84119 WP_001292011.1.84227 WP_001292011.1.84343 WP_001292011.1.85179 WP_001292011.1.852 WP_001292011.1.85296 WP_001292011.1.85914 WP_001292011.1.86535 WP_001292011.1.87011 WP_001292011.1.87033 WP_001292011.1.87307 WP_001292011.1.87395 WP_001292011.1.87807 WP_001292011.1.87880 WP_001292011.1.87882 WP_001292011.1.88071 WP_001292011.1.88296 WP_001292011.1.88344 WP_001292011.1.887 WP_001292011.1.89248 WP_001292011.1.89303 WP_001292011.1.89477 WP_001292011.1.89574 WP_001292011.1.89608 WP_001292011.1.90068 WP_001292011.1.90214 WP_001292011.1.90411 WP_001292011.1.90530 WP_001292011.1.90664 WP_001292011.1.90666 WP_001292011.1.90867 WP_001292011.1.90941 WP_001292011.1.91002 WP_001292011.1.91223 WP_001292011.1.91285 WP_001292011.1.91673 WP_001292011.1.91731 WP_001292011.1.92219 WP_001292011.1.92320 WP_001292011.1.92590 WP_001292011.1.92647 WP_001292011.1.933 WP_001292011.1.93303 WP_001292011.1.93323 WP_001292011.1.93537 WP_001292011.1.9386 WP_001292011.1.93884 WP_001292011.1.94370 WP_001292011.1.94532 WP_001292011.1.94803 WP_001292011.1.95950 WP_001292011.1.96087 WP_001292011.1.96406 WP_001292011.1.96868 WP_001292011.1.96943 WP_001292011.1.9741 WP_001292011.1.97621 WP_001292011.1.97836 WP_001292011.1.97850 WP_001292011.1.98063 WP_001292011.1.9822 WP_001292011.1.98773 WP_001292011.1.98979 WP_001292011.1.99017 WP_001292011.1.99019 WP_001292011.1.99056 WP_001292011.1.99241 WP_001292011.1.99286 WP_001292011.1.99447 205921.SAK_1772 gi|76788666|ref|YP_330369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]