SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283777855|ref|YP_003368610.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283777855|ref|YP_003368610.1|
Domain Number 1 Region: 33-126
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000642
Family Histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283777855|ref|YP_003368610.1|
Sequence length 139
Comment anti-sigma regulatory factor, serine/threonine protein kinase [Pirellula staleyi DSM 6068]
Sequence
MASENSNETRHWSFPSSSDTASQVVQEIFAMLEALEWSGHDLFAVHLAIDEAIVNAVRHG
NKFDTEKIVEVSVEISPRSFFIEVIDEGLGFNPADVPDPTADENLDKPSGRGVMLMKSFM
TEVDYLGRGNHLRMRKVRG
Download sequence
Identical sequences D2QZJ2
WP_012909015.1.69553 gi|283777855|ref|YP_003368610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]