SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283777886|ref|YP_003368641.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283777886|ref|YP_003368641.1|
Domain Number 1 Region: 34-172
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000929
Family LacY-like proton/sugar symporter 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283777886|ref|YP_003368641.1|
Sequence length 183
Comment hypothetical protein Psta_0084 [Pirellula staleyi DSM 6068]
Sequence
MSHPEPLNPYAPPQLASDETQRVVRLVAELPPRGPTLWVATVIVLLGSMIIASLAVYLLG
VWFEVIPPTRLGLDPTSKSFEPIGAASLNLLLVSVVMSFGQVRSVLFGDRVWSRMVAWGL
LLGAGIMFVGSYFLSRGEITDVLLVTPAVLMLWLGIVMYRWYLVLLEVFRKQQRVLRESR
KPE
Download sequence
Identical sequences D2R0B3
gi|283777886|ref|YP_003368641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]