SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283777967|ref|YP_003368722.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283777967|ref|YP_003368722.1|
Domain Number 1 Region: 302-640
Classification Level Classification E-value
Superfamily UROD/MetE-like 1.96e-103
Family Uroporphyrinogen decarboxylase, UROD 0.000000417
Further Details:      
 
Domain Number 2 Region: 10-270
Classification Level Classification E-value
Superfamily HemD-like 1.7e-49
Family HemD-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283777967|ref|YP_003368722.1|
Sequence length 641
Comment uroporphyrinogen decarboxylase [Pirellula staleyi DSM 6068]
Sequence
MSTETANFEGLRVASLESRNRAEMARLIEKLGGQPFVSPSMREVPIATNPAAVEFAQKLI
TGGIDAMIFLTGVGFRHLLAQVEKHVDRERFLHALSDITTICRGPKPVAAMREVGLTPTV
KVPEPNTWRDLLATIDAQVPIANLNVGLQEYGITNHSLVAGLEARGAQVLQVRVYQWDFP
EDTTELEANIRAIAALERDVVMFTSAHQVVNMLRMAEQLGLLQDVRDALRQMVVASVGPT
TSEMLREQDLPVDIEPEHPKMGPLVVAAAARSSQVLTRKRRIASTLSGPMTDALDQNAPW
YDSPFLKACRGEPTDVTPVWLMRQAGRYMEEYRAVRGQVTFLDLCKNPSLCSEIMCTAVK
RLGVDAAIIFSDLLPILEPMGLDLEFAKGEGPVIHNPLKTAADVDRVKELEELGSLDFVF
ETVRQTRADLPEDMPLIGFAGSPFTLASYAIEGGSSRNYLTTKSLMYSDEGAWTALMQKL
SRSITRYLNAQIASGAQVVQLFDSWVGCLGPYDYRRYVLPHVASIIDGITPGVPVINFAT
GNPALLPLLAEAGGRVIGVDWRVSLADAWKTVGYDRSVQGNLDPITLLGPRDELKRRVKL
VLDEAAGRAGHIFNLGHGVLQQTPVDNAIAVVDFVHELSQR
Download sequence
Identical sequences D2R0J4
gi|283777967|ref|YP_003368722.1| WP_012909127.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]