SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283778263|ref|YP_003369018.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283778263|ref|YP_003369018.1|
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily CheY-like 5.61e-23
Family CheY-related 0.01
Further Details:      
 
Domain Number 2 Region: 200-307
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000761
Family Histidine kinase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283778263|ref|YP_003369018.1|
Sequence length 323
Comment response regulator receiver protein [Pirellula staleyi DSM 6068]
Sequence
MPKVLVIDDTAVDRHLVAGLLERSTALEVQSVASAREALAALEAMLPDLVITDLMMPGID
ASAQVSRSRTKATSADREVFESGGLQLVEAVTTKYPSLPVIVVTSAGTEQAAVDSLAAGA
TTYIPKAHLAQQLVPTVLDVLARVADGVAHKKLLACLREGALLFELSSDPELIPPLISYA
QSLLTSVGLCDDSSVIRVSIALEEAIRNAMFHGNLELTSEQREGDPVEYQELLALRSCME
PFRSRRLHLSFRVSIEQATFVIRDEGPGFDPRKLPDPTDPANIEKVSGRGLLLMRTFMDE
VHFNATGNEVTMIKRASVSREGA
Download sequence
Identical sequences D2R3C7
WP_012909423.1.69553 gi|283778263|ref|YP_003369018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]