SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283778392|ref|YP_003369147.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283778392|ref|YP_003369147.1|
Domain Number 1 Region: 32-306
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.99e-66
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 423-552
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000196
Family YkuI C-terminal domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283778392|ref|YP_003369147.1|
Sequence length 748
Comment serine/threonine protein kinase [Pirellula staleyi DSM 6068]
Sequence
MSADYTQQQTPADQERSKNLSLKRTQPPTQVPGYEAQRLLGAGAYGEVWVGLNTTTGRQV
AIKFYAHRKGVDWSLLAREVEKLVFLSADRYVVQLLDVGWNAEPPYFIMEYIENGSLDDF
LRTHGPLSVPEAVELFEEIATGLSHAHGRGVLHCDLKPANILLDTDHKPRLADFGQSRLS
SEQKPALGTLFYMAPEQADLEAVPDVRWDVYALGAILFCLVVGHPPHRHPDAVGQIETGQ
TLADRLARYRKLINTSPLPPAHRRVRGMDRALADLIDRCLAPDPRDRFDNVQEVLDALQA
RRRARARLPLMVLGFLLPMVLMFVMAIFGSRAYDRALEQTETLARQRALENNRFAAELAA
ERATGELADYFEVARDEAARSELREALAPVLTSQRLADLSMHSASDPQATAARQRFVDDS
IRQTLNRWLETRMQTYRALADKDRRAPQFASIFLTDPRGTQIAAAHDEEVQSQSIGRNFA
HRSYFHGGVDEMEPFDTVPTSPQHIERTFLSGVFKSSTTKQYKIAISTPLYREVDGVKLF
DGVLTITLNLGDFEFSRLSSPSLDRFAVLVDGRAGEEEGTILQHPLFDQLLTTRKSLPEE
FHTLRVPSEVCQGADAPAYFDPLGKHTLGKDFDRQWIAAAAKVRSPSSSAGGAPSGLVVL
VQEDYGAVIEPVRQMGSGLLRLGLMATLVVVAVSGGLWGLVVYLFREKRTRIKRRSPMAS
MPTPQQELPTLVAGARPRNIGDEKTIDS
Download sequence
Identical sequences D2R4D9
gi|283778392|ref|YP_003369147.1| WP_012909552.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]