SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283778451|ref|YP_003369206.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283778451|ref|YP_003369206.1|
Domain Number 1 Region: 211-351
Classification Level Classification E-value
Superfamily GAF domain-like 6.54e-25
Family GAF domain 0.0027
Further Details:      
 
Domain Number 2 Region: 441-568
Classification Level Classification E-value
Superfamily CheY-like 4.84e-20
Family CheY-related 0.017
Further Details:      
 
Domain Number 3 Region: 71-175
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000838
Family PYP-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283778451|ref|YP_003369206.1|
Sequence length 577
Comment PAS/PAC sensor protein [Pirellula staleyi DSM 6068]
Sequence
MSVRRRILFVCSPHRPADALPSELRSNSEVVEVHHPLRAIARLMREKFDGVYVAAEHFNE
AVRLGRLLENDRILEGMPDAVALLDADSTILWANERLRSWSHRGNIVGESFFQALSNPEV
VGSELTPFTSAVRLNRATTSTLKTSDGRYLHLHAAPVTDPKENTRHLVVTARDVTVETQQ
QQKLHAIQDAGRELADLKPDEIFDMPIEQRVDLLKANILHCTKDLLKFDVVEIRLIDEKN
NQLVPLLEMGMDPEAANRILYADKERNGVTGFVAATGKSYLCEDTASDPMYLQGVKDAKS
SLTVPLKLHNEVIGTFNVESPQPGAFSDSDLQFLEIFCRDLAVSLNTLQLLAAQRANACQ
ESVEAIHSEVALPIDEILSDAIFVTERTEGLPPEMQARLQTILRNARDIKRVIQNVGRKM
APADAVPAAQHTQQRPKLVGRRVLVVDAEQAVRSSAHALLERYGCVVETAQRGAEAEMLY
QHSLRDGRYDVVLTGTKLPDMSGYDLMMRLKRMVDPVPLILMSEFGWDAGHTLVKARQAG
LHTRGNIMKPFILPQLLDTVEVIIEWSLLPIEAPAQA
Download sequence
Identical sequences D2R587
gi|283778451|ref|YP_003369206.1| WP_012909611.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]