SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283778520|ref|YP_003369275.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283778520|ref|YP_003369275.1|
Domain Number 1 Region: 160-391
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.62e-25
Family Extended AAA-ATPase domain 0.00027
Further Details:      
 
Domain Number 2 Region: 361-458
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000206
Family FIS-like 0.016
Further Details:      
 
Weak hits

Sequence:  gi|283778520|ref|YP_003369275.1|
Domain Number - Region: 14-108
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000166
Family Heme-binding PAS domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283778520|ref|YP_003369275.1|
Sequence length 482
Comment PAS modulated Fis family sigma-54 specific transcriptional regulator [Pirellula staleyi DSM 6068]
Sequence
MPRKPSLSRTLLKLIHDATSPLYVLDASRKIIFVSPALETLLAITAEQIVGLRADYSTAA
DGILGVAASLALPPQPHAERLKLSLLTTTGQLHPRMATASQLMLPSGIAATLVVVEATDT
AIDETLASRAGSGELTSDQLHQLLATLRQSQLGRYHTDKLIGNSVAISRVREQIALAAKS
HSRVLVTGSEGTGREHVARTIHLARDWKNIPLPIVDCAVMDAELLQSTLTGIISRHLARE
AASGESASKNIPPTALLLGVDKLKSDAQQELASFLLLPGVNLLTLATSRYSLQKLAQKGK
FRRDLAFALSTLTIALPPLKSRLEDLPLLAHWFVEQENLSRASQLSGVAPAAIELLAASS
WTGNIEELAQVIREGCARATGRELTAADLPDRVHLAAGVLKHPPREVAKIVLDDFLADVE
KQLLERALRESRNNKSRAAELLGISRARLLRRLAQLGLAPATAADIAADEPVIFEPLPDS
PS
Download sequence
Identical sequences D2R5F6
gi|283778520|ref|YP_003369275.1| WP_012909680.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]