SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283778750|ref|YP_003369505.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283778750|ref|YP_003369505.1|
Domain Number 1 Region: 480-591
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-30
Family DNA gyrase/MutL, second domain 0.00039
Further Details:      
 
Domain Number 2 Region: 34-166,193-274
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.89e-23
Family DNA gyrase/MutL, N-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 353-407
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000478
Family DNA gyrase/MutL, second domain 0.0012
Further Details:      
 
Domain Number 4 Region: 277-349
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0000000294
Family Topoisomerase VI-B subunit middle domain 0.0092
Further Details:      
 
Domain Number 5 Region: 424-478
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.00000412
Family Topoisomerase VI-B subunit middle domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283778750|ref|YP_003369505.1|
Sequence length 670
Comment DNA topoisomerase VI subunit B [Pirellula staleyi DSM 6068]
Sequence
MLDANSESTTPEAPQRRATAESMATKQRDISVSEFFAKNRHLLGFDNPRKALLTTVKEAV
DNSLDACEEAGITPEIWVTMASTGNNRYQVTVQDNGPGIVKKQIPLIFGKLLYGSKFHRL
RMSRGQQGIGISAAGMYGMLTTGKPVRIVSKLSPKKPAHYFEIQIDTKRNHPEIINGKGE
GEDIETDATTLDKRGICWQTMYPAEGEKPATEVKSGTSVTIELEGKYIRGRGSVDEYLEQ
TAIANPHVTIHYFDPDGGSISYSRSTTELPPEPKEIKPHPYGVELGRLVTMLKDTPAGTI
SQFLTDSFSRVSSSVAKEICDTAKISTRANCKRIGRQEVDALYQAIQATKISAPATDCIT
PIGEPLILKGLHHVVPGEFYAAATRPPAVYRGNPFQIEVGLAFGGVSAAQKVSLEALTEL
LSESDARTLRQFLMSTFDGVGSDASERILSEAQFGSRQSPSKLTKDEIATLHAAMRNVNL
SEGQTMQVLRYANRVPLQFQHAACAITQSVIATNWRSYGVSQSRGQLPQGPLTIMVHMAS
VWVPFTSESKEAIAGYPEIQKELRLGLQAVGRKLGIYLNRRNKVKQEGERRSIFLRYLNE
VATAINTIDEKHDKTKLYESLLQVAKKKTAEADAKFDDRGRRIEKQEEEDFGEHVLIVNQ
NEEEGGVTAS
Download sequence
Identical sequences D2R7E9
WP_012909910.1.69553 gi|283778750|ref|YP_003369505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]