SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283778882|ref|YP_003369637.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283778882|ref|YP_003369637.1|
Domain Number 1 Region: 100-262
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.26e-31
Family Histidine kinase 0.0032
Further Details:      
 
Domain Number 2 Region: 40-107
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000628
Family Homodimeric domain of signal transducing histidine kinase 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283778882|ref|YP_003369637.1|
Sequence length 262
Comment histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MPDPAPTSSTTTSLDELLKLVDDPLARKRLAAELPKLLEQQKLASLHAFAYGLSHEINNP
LANIATRAQTLLADEPHPDRKRRLAVIVAQAFRAHEMLADVMLFAKPPRLNRETVLVFSL
LRELVDQFQSEAAAQQTSLTLVPPGDETAEQVAISADPVHLKMGVQAMLRNALEAVAHQG
AVTLQLCVASKTIAIVVRDTGPGLSEEAREHLYDPFYSGREAGRGLGLGLSKTWRIAELH
GGAIAAENLAPTGCQFTLTLPR
Download sequence
Identical sequences D2R8G0
gi|283778882|ref|YP_003369637.1| WP_012910042.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]