SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283778981|ref|YP_003369736.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283778981|ref|YP_003369736.1|
Domain Number 1 Region: 322-516
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 9.01e-55
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 54-238
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.01e-51
Family Methylesterase CheB, C-terminal domain 0.00044
Further Details:      
 
Domain Number 3 Region: 918-1027
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.33e-27
Family Heme-binding PAS domain 0.00019
Further Details:      
 
Domain Number 4 Region: 1124-1234
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-18
Family Histidine kinase 0.048
Further Details:      
 
Domain Number 5 Region: 252-323
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000068
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0092
Further Details:      
 
Domain Number 6 Region: 776-881
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000188
Family Flavin-binding PAS domain 0.051
Further Details:      
 
Weak hits

Sequence:  gi|283778981|ref|YP_003369736.1|
Domain Number - Region: 691-776
Classification Level Classification E-value
Superfamily Tropomyosin 0.000161
Family Tropomyosin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283778981|ref|YP_003369736.1|
Sequence length 1238
Comment MCP methyltransferase/methylesterase [Pirellula staleyi DSM 6068]
Sequence
MAAKKRGKMSATGTEGADSPPEPIVAAKVPEPNRDYPAELAEEDDLDSKRGRPEFPVAGL
VASAGGLDAFKKFFAAMPADSGIAFVLIPHLAPTHSSLMVELVARQTSMPVVEATEGMAV
EANRVYIIPPNKNMTIEGGVLRLTGPVERVSWQTSIDFFLRSLADDQMEKAICIILSGTG
SHGTLGLKAVKAAGGIALVQDPSTADYPGMPASAIATGLADHVLPVEQMPEVLVKDVRHF
LANGGRVIAEVEEAPDHLNQLLALLRARTKFDFRGYRKKMLARRLERRLGLSNFENLADF
LAHLRQHPEEVKQLARDLLISVTRFFRDPEAFHYLETEVVAPLLQTKDADTPFRVWVPGC
ATGEEPYSIAMLLLEHQSLAQNPCRLQIFATDIDEPALEIARRGLYPDEIAADVSPERLA
RFFTRVDEVHWQVSKQLRETVTFAFQNLIADAPFSRMDVISCRNVLIYLEPDVQRKVLAL
LHFALKPGGYLFLGPSETIGRQTELFEPVSKKWRIYKRTGPLRAEDLQFPVTQSEPRPAL
PPSTNRAPVPPKLAELAQNSLLRRFDLACVVINRNYEVLHFAGPTEDYLVQPGGAPTQNL
FAMARPGLASKLRVVIRRAIRENSPQRINDAILRRAGEPCRVNIEAEPLHTSKQTTGLLL
ISFQAQRHPAGESPLDLGARGETDEPDLLHQLERELETTRDDLQNTIEQLESANEELKGS
NEEVMSMNEELQSANEELETSKEELHSYNEELSTVNNQLHDKIEEVESATNDMANLLDTT
DIPTIFLDGSLRIKLFTPASSRMFRIIATDRGRSIGDIVKRFIDDDLLPEIQQLLRNLIP
REKEVRAEDGRWYVRRILPYRTLDNRIDGVVITFVDITERKLTAEGVAQQHAKVVETSAG
VLHNREAHLAAILDAAADAIITIDAKGLIQSVNAAAERMFGYAADEMIGQNVKMIMPSPY
RGNHDQYLARYQQTGMKHIIGNGREVEGLRKDGSTFPVDLAVSEVNHLHLYTGILRDISH
RKQLEREVVEIASLEQRRIGQDLHDSVSQELTALSMLAGDLAETLRTDPLNASDLVERVV
QGLHRSRQDLRAVMRGLCPVSVDSEGLMAALSDLASRTQLEGKLSCTFDCPKPVLVEDNL
IATHLYLIAHEAVHNAIKHAQCKNIRISVESSEDLTLRVQDDGIGISIPDQPTQGHSGLG
LRIMRNRAAIIRATLSFEKVLPAGTMVTCVLDRRSHEP
Download sequence
Identical sequences D2R949
gi|283778981|ref|YP_003369736.1| WP_012910141.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]