SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283778995|ref|YP_003369750.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283778995|ref|YP_003369750.1|
Domain Number 1 Region: 510-529,570-814
Classification Level Classification E-value
Superfamily HAD-like 3.77e-49
Family Meta-cation ATPase, catalytic domain P 0.00088
Further Details:      
 
Domain Number 2 Region: 298-411
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.84e-24
Family Calcium ATPase, transduction domain A 0.0068
Further Details:      
 
Domain Number 3 Region: 247-299,412-505,768-775
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.36e-19
Family Calcium ATPase, transmembrane domain M 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283778995|ref|YP_003369750.1|
Sequence length 827
Comment heavy metal translocating P-type ATPase [Pirellula staleyi DSM 6068]
Sequence
MTAKTKLEIALLLPKVLDARDACIQRLSDLLKGKEGIETAHLVEHAAQGRDEICIHYDPQ
RLSLGAVRDLARRAGAQLDQRYGHLLLSAETMYAQQALTAEARARQLPGVLDAAISPSGA
LRIEFDRHATDDQAILAGLRTLGLRIIEPQAKAAPAESHAAVARPHLGQHDHKQEHEHRR
FFGERTELIFALICGGLLLGGWLLSTFASFSPWVPIGIFLAAYFFGGFFTLLEAIKSIRV
GRFEIDFLMLVAAIGAATLGEWAEGALLLFLFSLGHALEHYAMGRAKRAIEALAELAPQI
ALVRRDNKTEEVAVQQLRLADVVVIKPNERIPADGFVILGEGSVNQAPITGESVPVEKRP
VEDIPQAAANPDRLESQHRVFAGTINGSGSLEIQVTKLSGDSTLARVVKMVKEAETQKSP
TQRFTDNFERYFVPAVLGTVTLLLFAWVVIDEPFSMSFYRAMAVLVAASPCALAISTPSA
VLSGVARAARGGVLVKGGAPLENLGRLSSIAFDKTGTLTEGKPRLTDVVCSAGVTENELL
QVAVAVESLSDHPLAAAVVLGGKARLRSDPVLAAQDVQSITGRGVKATVDGQQIYIGKER
LFAEVEGTPLPEFLRAADDQLKASGRTTMIVRRGDSYLGVLGLMDTPREAARQVIRRLHT
LGIKRMIMLSGDNQQVASAVATAVGIDEAQGDLMPDAKVAAIKKLNLAGGVAMVGDGVND
APAMANATVGIAMGAAGSDVALETADVALMSDDLNHLPFAVGLSRQTSRIIRQNLWLSLG
MVAFLVPATILGLRLGPAVLLHEGSTLLVVLNALRLLAYQDSSAPAP
Download sequence
Identical sequences D2R963
gi|283778995|ref|YP_003369750.1| WP_012910155.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]