SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283779020|ref|YP_003369775.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283779020|ref|YP_003369775.1|
Domain Number 1 Region: 10-202,233-437
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.88e-60
Family Glycerol-3-phosphate transporter 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283779020|ref|YP_003369775.1|
Sequence length 443
Comment major facilitator superfamily protein [Pirellula staleyi DSM 6068]
Sequence
MSLTSRLSPLGFAWLVVGLLMPVALLNYLDRQMLASIKSSVMADIPSIGSDENWGFMLGQ
FKWVYAFMSPIGGYIADRFSRRLTICASLFVWSAVTFWTGHVDSYQELLTARSLMGLSEA
FYIPAALALIADLHTGQTRSKAVGMHQMAIYCGVIVGGFTGYIADAEWLGWRAAFDICGV
FGMLYAIPLALVLRDAPRPAELALVGVLKVRRYPATASRSKRGRSQLVAPKVVDERPSPW
SAAVALLLNLNFILLVLYFTLPALAGWVVRDWMPAILKKEFDLGQGIAGVAATLPWQAAA
IVGSLLGGTIADSWMRVNHRGRIYLSAIGMTLMVPAIAGVGFAPTLTLVVILLLLFGLGW
GFFDCNNMPILSQIVRPDLRATGYGIMNLVSISCGGLADWGFGALRDRDVPLGAIFGVFA
ATAAISAVLVLLIRPAPPTSPRD
Download sequence
Identical sequences D2QW40
gi|283779020|ref|YP_003369775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]