SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283779044|ref|YP_003369799.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283779044|ref|YP_003369799.1|
Domain Number 1 Region: 191-241
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000116
Family AraC type transcriptional activator 0.0085
Further Details:      
 
Domain Number 2 Region: 21-130
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000227
Family Heme-binding PAS domain 0.03
Further Details:      
 
Weak hits

Sequence:  gi|283779044|ref|YP_003369799.1|
Domain Number - Region: 140-186
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00269
Family AraC type transcriptional activator 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283779044|ref|YP_003369799.1|
Sequence length 243
Comment AraC family transcriptional regulator [Pirellula staleyi DSM 6068]
Sequence
MSHSLLHSVLAQLAEPFTGEMIFDALSDVVFFLKNDQGQYVLVNQTLAMRCGMSDKQSLL
GKTAADVLPAPLGHNCLEQDRRVITSGVPLLNELELHLYPSGDEGWCLTNKLPLRGVGEK
CVGLVGFSRDLHAPTEDYRDVAEALRKVQTRLEQPMTVDDVAKLAGLSTFQLDHRIREVF
HVSASQLMLKFRLDRATQRLRDTMLPIAHIALEIGYADQSSFTRQFHRTIGLTPAEYRKR
YQA
Download sequence
Identical sequences D2QW64
gi|283779044|ref|YP_003369799.1| WP_012910204.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]