SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283779168|ref|YP_003369923.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283779168|ref|YP_003369923.1|
Domain Number 1 Region: 6-215,328-406
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.78e-70
Family Bacterial dinuclear zinc exopeptidases 0.00000202
Further Details:      
 
Domain Number 2 Region: 214-325
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.62e-24
Family Bacterial exopeptidase dimerisation domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283779168|ref|YP_003369923.1|
Sequence length 416
Comment peptidase T [Pirellula staleyi DSM 6068]
Sequence
MTINSQRLLERFLRYVKIDTTADDSSTTFPSSPGQAVLSKLLAEELRQMGLTDVLVDEFE
IVYATVPSNVKHQSPVLALNAHVDTSPETTGKNVNPQVIHHYTGVDLPLPANPEKVLRVS
DNPELTALVGKTIITTDGTTLLGSDDKSGVAVIMELANYLVEHPEVPHGDIRLLFTCDEE
IGQGVKHVNLERLAADVCYTLDGSGSGEIDVETFSADLATITVKGINIHPSIGKGRMVNA
VRGAARFVELMPSDKLAPEVTEGRDGFMHPYTIEGGVAEVKIKVLLRDFDARQLADQAAM
LQSIAKQVEKEIPRLAVDVHVRKQYRNLAEGLAQEPRAVKLAEEAFRRLGRPFKQTIIRG
GTDGSQLTERGLPTPNLSTGEHNPHSPLEWTCLEEMVAACEVLVELSQLWGKETKN
Download sequence
Identical sequences D2QWV9
WP_012910326.1.69553 gi|283779168|ref|YP_003369923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]