SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283779178|ref|YP_003369933.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283779178|ref|YP_003369933.1|
Domain Number 1 Region: 691-1192
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.81e-98
Family Acetyl-CoA synthetase-like 0.0000181
Further Details:      
 
Domain Number 2 Region: 447-642
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 2.09e-27
Family Glycerol-3-phosphate (1)-acyltransferase 0.019
Further Details:      
 
Domain Number 3 Region: 48-463
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-21
Family LacY-like proton/sugar symporter 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283779178|ref|YP_003369933.1|
Sequence length 1198
Comment AMP-dependent synthetase and ligase [Pirellula staleyi DSM 6068]
Sequence
MTKPPASDNQPATSPVLVPSAEAETNQELVGQYGLGSIAFLSLLVTQFLTAVNDNIFRWL
VIGVAKQYVKEEEISYVLVGGTAGFVLPYLVLASPAGYLADRFSKSSVIFVCKVAEIVIM
ALGVGAIALGHANETWAFYSIFAVVSLMGAQSALFAPARAGSLPEVLRPELLSKANGFFG
LATVIATVIGMIVGCKVSDYTVPKGLEHLWVTAAVLIGVAVVGTITAWPLKKLPAGAPWR
KFPWDFPVQTYRDLRTLASNLPMLRVAVGILFFYAIGSLAQLNIDQLATEGGANAESDKV
PLLLALIAGVCVGNVLAGYWSGDHVELGILPLGAAGIALSSLLFCTVPVDLFQENVAISG
GVIWAMVLLVTLGISAGLFCVPLEAYLQHRSERASRGSILSASNFLTFSGICLSSILYAV
LRIPFWSTAEGTKSELFSPQSVFLLCGLLTIGVFFYIVLLLPQATVRFMMWLLASTIYRI
TIKGRHNLPATGGALLAPNHITWIDGLLLMLTSSRPIRMVAYAPNIENPWVKRLADMFGV
IPIHPARPKTIVQAFRTAREALANGELVCIFPEGGLTRSGQVQAFRPGTMKILDGVDVPV
IPVYFDGLWGSIFSFEAGKFFWKWPRRIPYPMSIHFGPPIAAAQDMHAIRQAVLALGSQA
TKERSAAMLSPTRWMIRQCKARKKTSKIADSMGGDLTGGELLARALVLRRLLRRGVLAND
EKIVGVLLPPSTGGMVVNMALALDKRVSANLNYTVTSDVMNACIAQAKIKHILTSRKFID
KLGEFKLDAEFVYLEDFATKPTLLDKIAAGLAAYVLPTWWVESSLGLQSIKPDDVLTIIF
TSGSTGTPKGVMLTHQNIGSNVEAIDQVVRLKSSDVLVGILPFFHSFGYTVTLWGVAALN
IKGIYHYSPLDAKQIGKLTKKHGGTLLLSTPTFMRTYLRRCEKDEFATLDVVVCGAEKLP
KELADAYEEKFGVRPVEGYGTTELSPLVSVNIPPTRRADNFQTDCKEGSVGRTVPGVSAK
VLHPETGEVCKAGEPGMLWIGGPNVMKGYLDQPELTNKVVKEGWYQTGDIAYLDDEGFIF
ITGRLSRFSKIGGEMVPHIKIEESLIQLLGEGEDEKPRIAVTSVSDERKGERLIVLHTQL
PKTTDELRKGLSELGLPNLFIPGADGFLLVDELPVLGTGKLDLKAMKSLAEKLTAEEA
Download sequence
Identical sequences D2QWW9
WP_012910336.1.69553 gi|283779178|ref|YP_003369933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]