SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283779193|ref|YP_003369948.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283779193|ref|YP_003369948.1|
Domain Number 1 Region: 495-663
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.28e-45
Family Histidine kinase 0.00091
Further Details:      
 
Domain Number 2 Region: 703-818
Classification Level Classification E-value
Superfamily CheY-like 2.99e-36
Family CheY-related 0.0019
Further Details:      
 
Domain Number 3 Region: 173-285
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-32
Family Heme-binding PAS domain 0.00014
Further Details:      
 
Domain Number 4 Region: 426-507
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.22e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 5 Region: 304-428
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.74e-19
Family Flavin-binding PAS domain 0.076
Further Details:      
 
Domain Number 6 Region: 19-148
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000445
Family PYP-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283779193|ref|YP_003369948.1|
Sequence length 827
Comment PAS/PAC sensor hybrid histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MGSPDRFANAEFHTEPSVVTRALEASLSTVDSLLDALSMHIAVIDSQGVVLGVNQAWRKF
GRENGIRATFNPVGSNYFEICQCAASSGAYEAADVAAQVREVAKAHRAEFTHEYPCNSPT
EQRWFRLRAAPYIWNNRRVVVIAHDNITPQKMAEMQARKNELALRAVLESAVDSIISIDE
HGIITSYNPAAERMFGYGPKELLGCNVSSLMPSPDRERHDGYLRRYLATGIPRIIGFGRE
ATGQRKDGSTFPIDLSVGEVLYEGRRAFTGIVRDISERKATEHALATSLKQREALLSAAS
EVSIIATDMHGVITTFNRGAEQMLGYSADEMVGVASPAVVHLHSEVLARSRELTKELGYP
VEGFRTFVELAERDGFEHREWTYIRRDGSQLLVNLVVTCVRDIDGQVIGYLGVAVDVTEW
KQSERELKLAKIAAEAANHAKSEFLANMSHELRTPMTAILGFVDIVAENVSSNPQLIDAA
ATIKRNGEHLMGLLNDILDLSKIEAGRLEVQKHSCNVRALTADVIQLMRVRSDAKGLELS
IEFQGAIPETIETDSTRLRQILINLIGNAIKFTENGRVQILVRLERRGTPMLEFEIRDTG
IGITPEQMTKLFRPFTQVDTSLTRKFGGTGLGLTISKRLAEILGGTITVSSKAGEGSSFL
LRIAAGPLATLKLTSVDGAAISVPAPQAAKPSVLASLPKISCSILLAEDGPDNQRLISFL
LTKAGASVELVDNGEKALQRALEGAFDIVLMDMQMPVMDGYEATRQLRSAGYAQPIVALT
AHAMAGDRQKCIEAGCTEYATKPIDRAQLIGLIARLTAAQSASDYLL
Download sequence
Identical sequences D2QWY4
WP_012910351.1.69553 gi|283779193|ref|YP_003369948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]