SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283779702|ref|YP_003370457.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283779702|ref|YP_003370457.1|
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily NTF2-like 1.1e-33
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.0000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283779702|ref|YP_003370457.1|
Sequence length 130
Comment calcium/calmodulin dependent protein kinase II association-domain-containing protein [Pirellula staleyi DSM 6068]
Sequence
MAAIETEVLALNQKLLVAIVTGDWKTYAELCDESITCFEPEARGQVVVGMPFHKFYFDLG
PATTARNVTMSQPHVRVIGDACVILSYVRLTQSLDASGAPQTGRVEETRIWQKVGSAWKH
VHFHRSPGAA
Download sequence
Identical sequences D2QZW4
gi|283779702|ref|YP_003370457.1| WP_012910860.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]