SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283779823|ref|YP_003370578.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283779823|ref|YP_003370578.1|
Domain Number 1 Region: 7-317
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.48e-105
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000224
Further Details:      
 
Domain Number 2 Region: 406-584
Classification Level Classification E-value
Superfamily RuvA domain 2-like 6.67e-56
Family NAD+-dependent DNA ligase, domain 3 0.0000607
Further Details:      
 
Domain Number 3 Region: 321-401
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.26e-26
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00099
Further Details:      
 
Domain Number 4 Region: 592-669
Classification Level Classification E-value
Superfamily BRCT domain 1.26e-19
Family DNA ligase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283779823|ref|YP_003370578.1|
Sequence length 676
Comment NAD-dependent DNA ligase [Pirellula staleyi DSM 6068]
Sequence
MSGVTPEILERLQALREAIRRHDYLYYVRAQPEISDLEYDRLMQDLTTIEASFPELVTPD
SPTQRVGEEPMEGLVQVAHRAPMLSIENSYTVEDLQKFAERTSKSLDGEAVEWVVELKVD
GVAISVRYENGLLVQALTRGNGEVGDDVTHNVRTIADVPLRLYGDKIPAVLEVRGEVYMT
NSDLVLLNKRQQELGKELYANTRNVASGTIRLLDPKLCAERKLRMLVHGVGVCEGMTAEN
HMQFLEQVSSLGLPPTPHCKCFATFSEAVKYCEEIPERLHELDFEVDGLVLKVNRFDQRA
KLGQRSKSPRWVIAYKFEKYEATTKLLGISVQVGKTGAITPVAELEPVQLAGTTVSRASL
HNADEIVRKDIRIGDIVVVEKAGKIIPHIVRVEAAERTTDLPVFQFPTHCPVCGSDVAKD
EGGVYIRCTNPSCPAQLREKLRFFATRGAMDIEGLGDKLVDQLVASKLVTCYGDLYRLTL
DKLTSLERMGEKSATKLLEGIVASKSRPLSRLLNGLSIRHIGSNGSQVLARHFGTLDAIR
QATLEDLSRVSEVGEITAASVYEFLHSDYGKTTIDDLVALGLNTQEPKSAIPTGEGIFAG
KTFVVTGTLSKFSRDEVEDLIEKHGGKASSSVSKKTDYLLAGAEAGSKLAKAESLGVKIL
SEADFIALLPTETAAD
Download sequence
Identical sequences D2R1J9
WP_012910981.1.69553 gi|283779823|ref|YP_003370578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]