SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283779846|ref|YP_003370601.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283779846|ref|YP_003370601.1|
Domain Number 1 Region: 298-480
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-41
Family Histidine kinase 0.0000101
Further Details:      
 
Domain Number 2 Region: 795-916
Classification Level Classification E-value
Superfamily CheY-like 2.85e-31
Family CheY-related 0.0015
Further Details:      
 
Domain Number 3 Region: 481-621
Classification Level Classification E-value
Superfamily CheW-like 1.7e-25
Family CheW-like 0.00029
Further Details:      
 
Domain Number 4 Region: 5-110
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 8.51e-25
Family Chemotaxis protein CheA P1 domain 0.00092
Further Details:      
 
Domain Number 5 Region: 236-295
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000981
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 6 Region: 658-773
Classification Level Classification E-value
Superfamily CheW-like 0.000000000157
Family CheW-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283779846|ref|YP_003370601.1|
Sequence length 921
Comment CheA signal transduction histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MNDADQQIVNDFVIEASEHLADIENQLLSIEASADSPNVELVHEVFRNVHSVKGVAGFLG
FASVGSLAHSLESVLNMVRGGELRPQGVVIETLLSGFDTLRQMVHHIDRVDDFDVTGHVN
QLQEIMNVAKIAPSAGELAAAGTSGGSAASQHPLDLAQQFVTDSGLQADPNAILASLREQ
MEPAAAPKANAQSSQQPKIASEPAPTSDAAINSKISAANGAAAESTPSKGSAADANIRVP
VAILDRLMNLAGELVLGRNQLLQILQNKSGAGLDTVGARLDQVTTELQEAIMNARMQQVG
TVFNRFPRMVRDVSQKLGKQCRLQLEGSEVELDKTILENICDPLTHLIRNAIDHGIERPE
VRAREGKSEAGTLTIRAFHQAGKVHITVSDDGGGIHPQNLRDKGVRKGWFSAEHAASLSD
REALRLIFRPGFSTAEVVTEVSGRGVGMDVVKTNIEKLGGTVEVDSTPGAGTTVHVKLPL
TLAIIPSLIVGSCGERYAIPESSIIELVRFTPGDKSMRVERFQGAEALRLRGTLLPLVRL
SSLLSTSSKKTPIATDTSRAHNIIVVEGGVVRYGIVVDAVLDPEQIVVKPLGRHIKSCRC
LAGATVLGDGQVAFILDIPGIAAHASLVAGESLEAENRRFATQDTAEETQTILLFQGLRG
DLFAAPMAMVSRIEKIGREQVDRVESRLLLQYRGGTLPLVQLEPGTQREELPESVYVLVF
QVKGYEMGLIVPLIVDICDASTAVDTRVYREKGTMGVLVIEGRVVRLLDVHELAASMAPP
QADNPRLQNSPLQGRRLTVLMAEDSPFFREQIGKFLTEEGHTVIACEDGLEAWETLQQPS
LQIDLVVTDVEMPRMNGFEFCRKIRSSAAHRHLPVIALTSLNEAKHVRMGAEAGVSDYQV
KMDRDKLLAAITKFMAQMKST
Download sequence
Identical sequences D2R1M2
gi|283779846|ref|YP_003370601.1| WP_012911004.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]