SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283780213|ref|YP_003370968.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283780213|ref|YP_003370968.1|
Domain Number 1 Region: 301-466
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.77e-30
Family Histidine kinase 0.0052
Further Details:      
 
Domain Number 2 Region: 179-228
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000183
Family HAMP domain 0.0091
Further Details:      
 
Domain Number 3 Region: 233-310
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000161
Family Homodimeric domain of signal transducing histidine kinase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283780213|ref|YP_003370968.1|
Sequence length 476
Comment histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MRWPLRRQILLPMVSVVLAAVLVVSVMNAYLASRQVIAEVDEQQADVVRTLAATNFPLES
SVLKQARGLTGAEYLIATLDGAATAASSDELLQLDTATLQSHGRGASIVAKLAGDDVELI
HFPAILDRRAVGGSQLQLHAFYPAKAWRAARFQAIWPPLAIGAVAIALTIAAAYVVALRV
TGPIDQLQKQVTQIAAGDYRQMPETSIDDEVHRLGQAINQMAQRLADYEEEIRRSERLRT
LGQLGGGIAHQVRNAATGCRLALDLLERDLESGRADIDANHESLEVATQQLSLIESYVQR
LLTLGRKETRELQPIDLRQTLLDLIPLVTPTASHLGIELATSLGDLPVPMRGDAPSLQQM
VINLLMNAIEAAADRRNLSGTGAVEIRLHSERPTSCEIEIIDNGSGVSEFAAAKMFEPFA
TDKPQGTGLGLCVAKQTAAAHGGEIRWSREQHQTHFFVTLPLLVSDVPHGEVAGSR
Download sequence
Identical sequences D2R4P2
gi|283780213|ref|YP_003370968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]