SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283780294|ref|YP_003371049.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283780294|ref|YP_003371049.1|
Domain Number 1 Region: 8-121
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000332
Family Heme-binding PAS domain 0.082
Further Details:      
 
Domain Number 2 Region: 185-233
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000287
Family AraC type transcriptional activator 0.02
Further Details:      
 
Weak hits

Sequence:  gi|283780294|ref|YP_003371049.1|
Domain Number - Region: 135-182
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00851
Family AraC type transcriptional activator 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283780294|ref|YP_003371049.1|
Sequence length 234
Comment AraC family transcriptional regulator [Pirellula staleyi DSM 6068]
Sequence
MSQVEIGLLERLFDRAPDVAFFVKDAAGRYVAVNESLVARHGLKSKSQVIGKCPRDICLG
DLGRIPTEQDEKVLRTGRPLIDHLEMQWHRPHDPVWCLTTKLPMFAPDGGVVGLIGFSRD
IRVQVPSHEIPSGFASALEQFEQSLSPEVTPAWLASRSQLSPQRLARLTKRLFGLTPNQF
ITKSRIAAASRMLRDSGDSVAEIAHACGFYDHSAFTRAFRSATGLTPTEFRARP
Download sequence
Identical sequences D2R5K7
gi|283780294|ref|YP_003371049.1| WP_012911451.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]