SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283780296|ref|YP_003371051.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|283780296|ref|YP_003371051.1|
Domain Number - Region: 2-29
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0737
Family PhnA zinc-binding domain 0.049
Further Details:      
 
Domain Number - Region: 64-132
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0746
Family ABC transporter transmembrane region 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283780296|ref|YP_003371051.1|
Sequence length 208
Comment membrane-flanked domain-containing protein [Pirellula staleyi DSM 6068]
Sequence
MKCPNCTAEVSETAAFCQNCGFALKGKEPMTPADEFRQKAQQRSAAEGDTEKDLWNGSFS
PKAMYGYWLLATVITVASLVVCVLFPLPPLIFFIVVVDFAIWLGMGAYLLYQRMGVAYHL
TSQRLIHHVGILRRVTNRIEMIDINDVSFEQGLIERMLGVGTIKILSSDTSHPSLVMPGI
DDVKKIAAMIDDVRREERRRRGMFIESI
Download sequence
Identical sequences D2R5K9
gi|283780296|ref|YP_003371051.1| WP_012911453.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]