SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283780394|ref|YP_003371149.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283780394|ref|YP_003371149.1|
Domain Number 1 Region: 1-450
Classification Level Classification E-value
Superfamily Preprotein translocase SecY subunit 9.29e-115
Family Preprotein translocase SecY subunit 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283780394|ref|YP_003371149.1|
Sequence length 461
Comment preprotein translocase subunit SecY [Pirellula staleyi DSM 6068]
Sequence
MWQKFRAIFTIPELRQKIIFTAILLGVFRIGYHIPLPVVNQAQLAANMDSQSNELAKFFT
NVAVFSAADLKQVTIFGLGIMPYISASIILQLLGSVWKPLEDLRKEGETGRKKINEYTRY
LTVAMCVVQSMMFLGTMLSSGDGQASTIHPDFLSGNSLHWSWYITCILTMTCGTMFVMWI
GEQIDEFGIGNGISLLIMAGILAQMPVALIDFTTNMKWSLTAFSEVGIEHIVVLAILFVA
VVFGVVFITLGQRQIPTQSAKHVRGRRQFGGGRQYLPLRLNQSGVMPIIFASSLLMLPAF
IFGLIASSFAGSESDSGQTTAKFFYELQGMFASGTSFTYIVCYVILIYFFSYFWTAITFN
PKEMADNLKDFGTFIPGYRPGRRTAEHLEKVMVRITYVGAAFLSLVAIVPTFVSSALNVA
PNVASFYGGTGLLIAVSVAFDLIQKIDSHLVMRDYRGLLEP
Download sequence
Identical sequences D2R6I9
gi|283780394|ref|YP_003371149.1| WP_012911551.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]