SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283780645|ref|YP_003371400.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283780645|ref|YP_003371400.1|
Domain Number 1 Region: 89-252
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.8e-43
Family Histidine kinase 0.0024
Further Details:      
 
Domain Number 2 Region: 24-94
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000235
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283780645|ref|YP_003371400.1|
Sequence length 281
Comment histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MSAEDRALSAQEEIEVLRRQLLEAQKLTAIGELLGTTTHEFNNVLMTILNYARLGIRHKD
EPTRDKAFEKILAASQRAAKITSSVLGMARNRSDSLEPTDVAAIIEETLVLLEREMMKYR
ISIEKQIGEVPPALACGNQIQQVLLNLLINARQAMLQGGRLLIKLEHDTSANTVDLVVRD
SGTGIPPEKLRKIFDPFFTTKPGPDESGRGGTGLGLSACKSIIEAHRGRIRVESTVGKGT
AFTIKLPVATKDSPKEISAPTTIPAISTSVATTTGEQSASS
Download sequence
Identical sequences D2R8J9
gi|283780645|ref|YP_003371400.1| WP_012911802.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]