SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283780710|ref|YP_003371465.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283780710|ref|YP_003371465.1|
Domain Number 1 Region: 1108-1268
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.37e-35
Family Histidine kinase 0.0028
Further Details:      
 
Domain Number 2 Region: 642-768
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.93e-28
Family Flavin-binding PAS domain 0.033
Further Details:      
 
Domain Number 3 Region: 1294-1412
Classification Level Classification E-value
Superfamily CheY-like 1.57e-26
Family CheY-related 0.0035
Further Details:      
 
Domain Number 4 Region: 892-1015
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.2e-21
Family Heme-binding PAS domain 0.013
Further Details:      
 
Domain Number 5 Region: 767-893
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.22e-20
Family Heme-binding PAS domain 0.038
Further Details:      
 
Domain Number 6 Region: 514-643
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.5e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.081
Further Details:      
 
Domain Number 7 Region: 386-514
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 8 Region: 281-390
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-18
Family PYP-like 0.037
Further Details:      
 
Domain Number 9 Region: 155-262
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000014
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.018
Further Details:      
 
Domain Number 10 Region: 1030-1100
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000186
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 
Weak hits

Sequence:  gi|283780710|ref|YP_003371465.1|
Domain Number - Region: 18-67
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0038
Family Heme-binding PAS domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283780710|ref|YP_003371465.1|
Sequence length 1413
Comment PAS/PAC sensor hybrid histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MVDLSAFTSRVTEVGASLELLFGGSEKPVLAIDGEGIIRFASQNAVSLVGPTGKTLVGLP
LVDLLAISESPLSGELELRSSFAAKLRHASVPQQLPLESIYILVQTQPLAIAHPHFAGWQ
LLFLTPETSYLPTDGSDYQGELSATGYRKLLDLAVNDGVSVMSLQGRHLFDNEAAVTISG
VSREELHTQTPFSRVHPDDMPMLRESWSQLATKPGTRVGPSYLRIMHHSGDWVWVEASGV
NMTEDPDIGGMVAVWRIVEEQRRTEALLRENRMMLDVALSAARMVAWEWEIDNDILKWTS
EEGQVYGISPLARVNNAAAFMELVHPDDRQLVSHLIQRSVQTGLDYAVEYRVVWPDGSIH
WVDARGKARRDAEGRPTHLVGVSIDIDQRKATEHQLRERELFLRMAMSSAKLAPWDFDLQ
SGLIKGDPLIGELFGAPMQNDRGRNEDFFARIHPEDLPRVERAIQSSIENHTDYMIEFRV
RHLDGSIHWLEGHGRVHTSPTGEPIRMVGVTLDIDHRKATEAALAESEERLRLTLEAAKV
GTWEWNLKTNSVAGSPELGPMHGRPRGMFHTSVECFLEAIHPQDRDDVRVAIVNALTGDG
NFAQDYRVIWPDSSVRWIADRGRTIFDGDGNPVRMLGAAIDITERKEVERRHREQEEQYR
LLADSMEDFVSLSDLNRRPHYVSPSFYRITGYSPEEIDQSDFSTRIHPDDVPAVEQARLD
NLRGLSTRIEYRFRCKNGNFIWLDLKATPVGLGDGKVDRIVCCARDITDRKLAELSALQS
EARYRELVELSPEAIGIVQDGAFVYGNPAAVELLAARDIDDFLGVKMEDVIHPDDLTSTY
ERVQHVVATQQAVPLRQIRAVRRDGKVITIETRVGPCVYGGKPAVQVIGRDVTQRLLTEE
ALRESEARWRSLVENAPDIIMMVDRSGLISFINKAGPGFRIEDVIGSSSLQFISPSSQMR
ARDAYARAWDYGETVDFEIEATPQNHESQYYEVRVSPIRSGERTVALINISRDITDRKRL
AEERLQIERKLQETQRLESLGLLAGGVAHDFNNLLTGVINYTVLAASKLAPKSSPVEYLE
KAETAARRAADLTRQLLAYSGRGKLVTQPLNVSSVVSEMRELLQTSISKRITFSLQLTSN
LPAVIADATQLRQVIMNLILNASEAIGTEIGVVTLKTHLVEATTESLISPYSSDLLPPGK
YVCVEVSDTGCGMVPATLQRIFDPFFSTKFAGRGLGLSAVLGIVRGHHGAIQVQSVPGSG
TTFRVLLPIQAGETEAPEQVATPLPAAPTAIGSSPLVLLIDDEEVARMSVEAVLLSENFR
VELAANGREGLELFSKIKDIDLVILDLTMPDLDGEQVFRVLRQQCPEVRVIITSGYSTEE
IALKHAGDDRVGFVQKATGPRALLSEIRRILGR
Download sequence
Identical sequences D2R8R4
WP_012911867.1.69553 gi|283780710|ref|YP_003371465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]