SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283780841|ref|YP_003371596.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283780841|ref|YP_003371596.1|
Domain Number 1 Region: 290-584
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.14e-68
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000306
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.6e-24
Family Flavin-binding PAS domain 0.063
Further Details:      
 
Domain Number 3 Region: 161-262
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-23
Family Flavin-binding PAS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283780841|ref|YP_003371596.1|
Sequence length 585
Comment methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor [Pirellula staleyi DSM 6068]
Sequence
MATLVRTRNTPSKTKSKTSNVEQLNVDYAGQVAAIGRSQAVIEFALDGTILMANANFLST
LGYNLEEIQGKHHSMFVEESHRQSYEYKEFWNKLGRGEYQAAEYKRIGKGGSEVWIQASY
NPILDREGRPFKVVKYATNITAQKLQNADYQGQISAISKSQAVIEFKMDGTIISANENFL
STLGYSLSEIQGRHHSMFIDESTRQSHEYKEFWNKLGRGEYQAAEYKRLGKGGREIYIQA
SYNPILDLNGRPFKVVKYATDITAQVFAREELKRKVDSMLEVVAAASSGDLTREISVKGQ
DSIGQMGEGLARFLTDLRRSVTSIAQNASALAGASEELSSVSTQMSSNAEETSSQANVVS
AASEQVSKNVQTVSTGVEEMNSAIREIAKNATDAAKVSQQAVTIANTTNATIAKLGESSA
EIGKVVKVITSIAEQTNLLALNATIEAARAGEAGKGFAVVANEVKELAKETAKATEDISR
KIEAIQGDTKGAVDAIKQISGVINQINDISNTIASAVEEQTATANEMGRNVAEASKGSGE
IAQNITAVASAAQSTTQGASNTQQAAGELSRMAAELQHLVSQFKY
Download sequence
Identical sequences D2R9I6
gi|283780841|ref|YP_003371596.1| WP_012911998.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]