SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283780944|ref|YP_003371699.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283780944|ref|YP_003371699.1|
Domain Number 1 Region: 389-554
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.07e-38
Family Histidine kinase 0.0041
Further Details:      
 
Domain Number 2 Region: 151-331
Classification Level Classification E-value
Superfamily GAF domain-like 1.48e-25
Family GAF domain 0.011
Further Details:      
 
Domain Number 3 Region: 2-94
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.63e-23
Family FHA domain 0.0027
Further Details:      
 
Domain Number 4 Region: 326-397
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000112
Family Homodimeric domain of signal transducing histidine kinase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283780944|ref|YP_003371699.1|
Sequence length 570
Comment GAF sensor signal transduction histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MATLFVMQGRDRGKRFELGDLPLSMGRESGNRAQLQDNEVSRRHAEVRKVDGGFVLFDLG
SSNGTFVNAQQVSEHKLSTGDRLQLGRTMMVFSDDDSGSLNSLVHEVNIVTHTADDGGSR
IVRSVRPDEAAGDLSAGGSAESPWLARARSNLQIMYRTALAVSHTLDIDQLLQRILEMIF
EWVEADRGCVMMIDHETGELTPIASRNRRGVKVDERLAISRTILDFVMDHKEGVLTSDAR
DDSRWDATDGSIVTLGVREAICVPLQGRYGIVGVIYIDTYTPPGKSLERRIGNRFSEEHL
KLMVAIGHQAALAVEDTSYYSAMVQAERLAAMGQTIATLSHHIKNILQGIRGGSFLIEEG
LRVTDNDVVRKGWRIVEKNQERISNLVMDMLTFSKQREPDPVAADMNECVSDVVELMQTR
AHEAEVELLFHPFEGLPLLMADPDLLHRAILNVVTNAIDACEKQPGGKVEVSVTYLPSEK
LLRIAVADNGEGIQPDDIKKIFSVFESRKGARGTGLGLPVSQKILREHGGDVRVESTVGA
GSTFYLEIPAHLPDASKTSNTLFSPPEMPQ
Download sequence
Identical sequences D2QWN6
WP_012912101.1.69553 gi|283780944|ref|YP_003371699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]