SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781005|ref|YP_003371760.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781005|ref|YP_003371760.1|
Domain Number 1 Region: 297-478
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-44
Family Histidine kinase 0.00094
Further Details:      
 
Domain Number 2 Region: 225-309
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 3 Region: 190-239
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000196
Family HAMP domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283781005|ref|YP_003371760.1|
Sequence length 495
Comment histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MFFEQLSAQFRTLRFRLMLWNATAVILTGIAVLVTLREGVRFALQAELDQVLTQDLQEIS
LYFSEEKQQLNWQRLEEELDRKARGHEFQGWFVQFFDARGLTAWSSSGTPGGLNLISIAA
SGRKRTSRDGYRIVFLDLPGADPRGKQVCVGSSQAFITRDMARLDRLTLLVGGIVLVLSP
LGGYLLAGRATRPLAEIIQTTASLRPSELSERLPLRDAGDELDHLAITINGLLDRIADYL
QEKHDFLANAAHELRTPLAAIRSSVEVALSKGRSSAEYEELLAEMIEECASLESLVNQLL
LLAESDADRLRVSAERTSLSDVVKTAIDMFQPVAEFRGLRIESYSLTPCTVIGNRLHLRQ
VMNNLLDNAIKFTAARYDDETNENRGSGVVRVSLFVNEEKGLAEVVVSDNGIGIPEKHLP
HIFERFYRVDRKRSRGSSVGGTGLGLCICAAIINAHHGEISATSRDNEGTTFRFTIPIAK
PLSSIAAAPATAVNS
Download sequence
Identical sequences D2QX60
gi|283781005|ref|YP_003371760.1| WP_012912162.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]