SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781082|ref|YP_003371837.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781082|ref|YP_003371837.1|
Domain Number 1 Region: 651-835
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-38
Family Histidine kinase 0.00000423
Further Details:      
 
Domain Number 2 Region: 836-973
Classification Level Classification E-value
Superfamily CheW-like 1.31e-26
Family CheW-like 0.00022
Further Details:      
 
Domain Number 3 Region: 15-142
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.62e-22
Family Chemotaxis protein CheA P1 domain 0.0017
Further Details:      
 
Domain Number 4 Region: 201-309
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.49e-18
Family Chemotaxis protein CheA P1 domain 0.0079
Further Details:      
 
Domain Number 5 Region: 523-557
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000149
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283781082|ref|YP_003371837.1|
Sequence length 987
Comment CheA signal transduction histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MAAMDQQLSDELGDSLLTDFLDEANQLLVKLNEDLLTLDEWVASRQAGQPSSFDSELMTS
MFRSAHSLKGLSAMLGLPHINQLTHRVENVFDAARKSELQLDSSNVQVIFSAIDSLEAMI
DMLKNTGNDEVDASEVMTRIENVLVEAGCHREAKSQQDAEAALAAITAEVTLLQAPSEPS
TLQEDEGIFAGIEDEQEVPSRYLAIFIDEADLSLDSLTETLVSDEQLAGDSATESLLITA
HRIKGSAASLGLHRAAKLSHLMEDLLQDLHNSGCRLKPSMVDALLKSTDALRGYVASLKA
GVPKYPQFAAAARDLCSSRELCASIADTKMPTSSAQESPASTAAPAIASLDHLTEASFVA
SLRQQFPTAENILVGQVRFDASQPLVGLKASLVYEKLCRAGQSLYNNPPGCDLENLDDLE
YFDFAISTTVPLETLRTQLLISGVSEVLLDLIADQPPVAAAPMVTLSSLAPVARTASAEP
KAAAAKLVDDDLPVSNDHPEAAVSDASAKSKAAERDTSNRPNETLRVDIERLDQLMNLAG
QLVINKARFTQIGEGIRETLPAKGTLQMLGNASMLIDRLCGDGESNSHLDEWDLDQAKSH
VRRVRADLQIIQRELSRLSKLRNRVNELFEAVHQLDRVADGIQKSVMDTRMVPIGPLFSR
FKRVVRDVTRINGKDIRLDIRGEKTELDKRMIDELGDPLIHMVRNSADHGVETSADRVAA
GKSAQGCITLDAFHRGNSIVIQVIDDGKGLDSQRILKKAIERGLVSEADAERMTSHQIYQ
LIWEPGFSTAEKVTEISGRGMGMDIVRSKIEGLSGTVEVDSTPGQGATFTIKLPLTLAIL
PSLMAAVDGDVFSLPIESIVEIVSVPRRQLSTVHGMLTASIRGRIVSVVNLKDIFTWRQN
SSRSTALETTDSTLVVLGHDGCEIGLVVDSVLGEDDVVIKSLAENYRNVRGIAGASILGD
GRVSLILDIPTLIEMASGLAELPAAVV
Download sequence
Identical sequences D2QXD7
WP_012912239.1.69553 gi|283781082|ref|YP_003371837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]