SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781084|ref|YP_003371839.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781084|ref|YP_003371839.1|
Domain Number 1 Region: 426-707
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.26e-72
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000388
Further Details:      
 
Domain Number 2 Region: 163-269
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.98e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.062
Further Details:      
 
Domain Number 3 Region: 22-133
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000454
Family Heme-binding PAS domain 0.025
Further Details:      
 
Weak hits

Sequence:  gi|283781084|ref|YP_003371839.1|
Domain Number - Region: 263-376
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000516
Family Heme-binding PAS domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283781084|ref|YP_003371839.1|
Sequence length 708
Comment methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor [Pirellula staleyi DSM 6068]
Sequence
MPKAVSKTTTTKAAPKSAQSEVKKLQQELALNRAMAENSPINILLADTNLHITYVNPASL
ATLKTLERFLPVKAEEILGQSIDIFHKDPSHQRRILSNERNLPKRSTIQIGDQYADLLVS
PTYDAEGKYMGPLVTWEVVTEKLLIESRNLDYQQQIAAINDSQAVIEFKMDGTILHANAN
FSKTMGYSLDEIKGQHHSMFASHEHAKSPEYKAFWAKLNRGESDEGRYSRVAKGGREVWL
QARYNVLVNKEGKPYKVVKYATDITENRRLEQAAAEKSAIVENAPINLMLANLQGIITYI
NPNSRRTLKTIEHLLPIKVDQIVGSSYDVFHKNPAHQRRLLSDPRNLPHATEIKIADEIL
SLQASAIYDSEGNYAGPMVAWEVITERKAAARREQENQERDRQNQEELRRKVDDLLAVVT
AAAGGDLTKDVSFNGTDALGQLADGFRRMMGDLRSIISQVVEGAGQFAEGSRIIAENAQS
QAQGAQTQSASVEEMSASIEELTRSIEAVKDNAGQANELAAGTSRMAEEGGSAVQKSIEA
MDLIKNSSEQISEIIQVISEIASQTNLLALNAAIEAARAGEHGLGFAVVADEVRKLAERS
SEAAKEISKLIKESTQRVSDGAKLSEQTGKALERIIQGVDSTAKKISEIATSTVEQAQNA
GEVANAIQQVSHVTEQSAAASEEMASSSEELGAQAASLRDLVRRFRTE
Download sequence
Identical sequences D2QXD9
WP_012912241.1.69553 gi|283781084|ref|YP_003371839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]