SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781106|ref|YP_003371861.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781106|ref|YP_003371861.1|
Domain Number 1 Region: 432-699
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-64
Family Protein kinases, catalytic subunit 0.0000148
Further Details:      
 
Domain Number 2 Region: 141-249
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000902
Family Sensory domain of two-component sensor kinase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283781106|ref|YP_003371861.1|
Sequence length 770
Comment serine/threonine protein kinase [Pirellula staleyi DSM 6068]
Sequence
MIDWLLRLFRIRPATSTAGQGHLTFGATSVGRTISRTGLLLKKQLWIWPIIAFVILATVG
FGIRIAIERTMKANLKSELETVLNIECAMLETWLKVQESNAQSMANDQQVRDVVAKIDAI
YQSQNAPLTTEAAEAVPATNPALLNQLLAQLGQELAPGMSVHNFTGYILADKQQKILASS
NTELIGRTFPEYEKFLSRVLEGEVIVTSPVASVVLLKDERGRVRTGVPTMLVVAPIRDSN
LQVIGAIGFRIRPERDFTRILQLGRLGETGETYAINKEGLLVSNSRFDDKLILLGLIPDL
EGSQSILTVSARDPGGDLTRGYRPQVRRAELPLTKAAESVIAGGSGVSLEGVNDYRGVPA
VSAWQWLPKYEIGIITKVDYEEAYRPLSILQIAFFSIFALLALSSVAIFIFTLVVTRLQR
EAQKAAIEAKHLGQYRLEERLGAGAMGIVYRGHHAMLRRPTAIKMLHVEKVNEASIERFE
REVQITCKLNNPNTVAIYDYGRTPEGVFYYAMEYLDGIDLQVLVNRYGPQPEGRVIHILK
SICGSLYEAHSLGLVHRDMKPANVMINRRGGQSDVVKVLDFGLVRALDEAKSSREQGGLT
GTPLYMPPEAIQTPDLVDARSDLYAVGAIGYFLITGQPVFQASSLVELCQLHVDAQPELP
SKRLGKTISVELESAIMACLEKSRAKRPQTARDLATLLDRCATSRSWTIEEADAWWGRHE
RSAASDASGTASSASQSADTSASRSAPGASRTASSGFDQTIAGGNDPANS
Download sequence
Identical sequences D2QXS4
WP_012912263.1.69553 gi|283781106|ref|YP_003371861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]