SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781275|ref|YP_003372030.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781275|ref|YP_003372030.1|
Domain Number 1 Region: 389-408,454-695
Classification Level Classification E-value
Superfamily HAD-like 2.57e-44
Family Meta-cation ATPase, catalytic domain P 0.00087
Further Details:      
 
Domain Number 2 Region: 194-290
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.48e-19
Family Calcium ATPase, transduction domain A 0.0062
Further Details:      
 
Domain Number 3 Region: 132-194,291-383
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000144
Family Calcium ATPase, transmembrane domain M 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283781275|ref|YP_003372030.1|
Sequence length 734
Comment heavy metal translocating P-type ATPase [Pirellula staleyi DSM 6068]
Sequence
MNTDREARATVDCSFCGLPTHNDAVDVAQVYCCTGCRFAATVTAADGDEGQARWTMTRLG
IAVFFAMNVMVFTMLLWSQDRVAADELSRLWYGVARFACLLFTLPVLFLLGGTLVEDAYL
ELRRGRPSLSLLLLLGVIGSLLYSVHSLLVTDGHVYFEVAAIILVAVTLGRWFEATGKLQ
TTAALRGLAKLLPAEVRKMLGSETEIAPADQLQVGEHFKVLPGERIAADGVIVQFAAAVD
EQVITGESMPVEKQVGDAVQSGSLVLDGPLVIEARAVPGEGMLARMIQAVEQAAASKCRY
QRVADSISSWFLLAVTITAISTFAAHCYWRGVAEGILAALSVVVIACPCALGLATPMALW
AAIGRAAQAGVMIREGDALSILASAPSCCFDKTGTLTTGQPTVIRFDHAHEYDEQTLLCM
IQALSSASNHPLAMALGNYAQLRCASAMLRDTSPDASWSEIEVIPGCGIRARSSSTGDIA
YLGNLAWLKREGLRAFTEFQLDLTCHDQCAETYFACEGAIVARVLFQEDLRPEAHIAVEE
LKQLGMSIDMLTGDREERAARLASDLAISYQSQLMPHQKLEVVTQKQQKSSVIMVGDGVN
DAPALAAADVSISLGCGTDISRNAASICLLQSDLRRIGWLVKLSRETVSVIRWNLFWAFG
YNAAGIALAAAGLLHPIIAAVAMGISSFLVVGNSLRLAHFPLELDGSPATSGDDPSDAPR
QHIATDHNEAQLIA
Download sequence
Identical sequences D2QYL1
gi|283781275|ref|YP_003372030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]