SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781294|ref|YP_003372049.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781294|ref|YP_003372049.1|
Domain Number 1 Region: 539-559,598-850
Classification Level Classification E-value
Superfamily HAD-like 4.78e-49
Family Meta-cation ATPase, catalytic domain P 0.00076
Further Details:      
 
Domain Number 2 Region: 343-440
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.54e-23
Family Calcium ATPase, transduction domain A 0.0085
Further Details:      
 
Domain Number 3 Region: 290-344,441-535,793-820
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.35e-18
Family Calcium ATPase, transmembrane domain M 0.017
Further Details:      
 
Domain Number 4 Region: 113-185
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 2.62e-17
Family HMA, heavy metal-associated domain 0.0011
Further Details:      
 
Domain Number 5 Region: 3-67
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000000785
Family HMA, heavy metal-associated domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283781294|ref|YP_003372049.1|
Sequence length 859
Comment heavy metal translocating P-type ATPase [Pirellula staleyi DSM 6068]
Sequence
MANLTFGVDGLTCGHCVKQVTAALSVLPGVEHVDVELETGTVRLDTRGDAPPREQLRSAI
EQAGFAMLDAPQLSTSQKSAPAQQPQLLQLGLAPSNPPTPTLQTTPVEERPASGETSVRL
SVSGMHCSSCVARVEQSLARVPGVEKVEVDFASNQARITSHRPLLGETLTAAVTAAGYQA
SIVDETSNHAATGQSRAHEETLQWRRQMIISIVLTAAVLVLENYGQSIARSWFSPSVAPT
AATAITAILVLLASLLQVVIGWPFYQSAWRSLAARSLNMDTHIVLGGTAAFGLGLYETLA
HGHGMGLGDAATILALVTVGRYLEAKFREQASESVTGLSSLLPQVTLVLRAGQLVEVPSS
QVQVGETIVIQPGASVPLDATVIEGQSSTSEAWLTGESMPVEKRPGDLLLAGSVNLDQSL
TAEVRSARGDSRVAKLTQLVEEMQFSKSKLQRLADQVVAWFTPALLAAGLLTFIVWFFIP
GSTWQNSLIRATSVLVVACPCALGLAAPLAMMVAAGRGAREGVLLKNAAAIEQAGKITTV
VFDKTGTLSLALPEVCAIKAAPGSSTTELLAVASAIERLSSHPLARAIVAKATADKVSCD
IAQQVRAVAGEGVEGMVRGERVLVGKRSLLSAHGIDVEPVVDDNLQSSESTSFTAKLRCH
VAIGNRYLGSIEAVEQLQPGCKEAIAALKASGLRVALLSGDTQSAAEELAARVGIDDVRG
GVRPEEKLAEIAARRSRGEVVAMVGDGINDAPALAAADLGIAVSTAVDVARQSADLVLFR
GELGQVARAIKLARLARRIVKENVLWAFSYNLILVPMAAGVFIPIFGIALPPAFAAAAMG
LSSVSVVLSSLRLRWQSLD
Download sequence
Identical sequences D2QYN0
WP_012912451.1.69553 gi|283781294|ref|YP_003372049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]