SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781416|ref|YP_003372171.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781416|ref|YP_003372171.1|
Domain Number 1 Region: 358-492
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.46e-16
Family Histidine kinase 0.014
Further Details:      
 
Domain Number 2 Region: 280-353
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000179
Family Homodimeric domain of signal transducing histidine kinase 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|283781416|ref|YP_003372171.1|
Domain Number - Region: 82-156
Classification Level Classification E-value
Superfamily CheY-like 0.000332
Family CheY-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283781416|ref|YP_003372171.1|
Sequence length 551
Comment histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MIGKTATPRGLVILKSRDLQQSLSAAFASIPAPPQASPTEAGSTPSSTATLDTNWQYYVV
EPCDCSSDSNCQSYVSLDRHSPLPPLTFIDWNLPTEVLDQLILQAMVGDSVPIAIVDHQN
ASGVVDAYHRGATEVLVWPASEAMLRKTLERAVRRIPLARLGSLATEQSALIADCFCLVD
RNATIVDCLSSITASLKVGTNLTSYFSAPHHEAITQQVEQVFTSHRAISMAIEARDQNAT
MLIDLRIIPCGEDHALVIVRDVASQCAAGDSRLEIAERYRFETAGHMVAGISHEVHQPLY
AIANFAGAAINTLRTTPVQDAAAKVIRWCEQITTQSHRAAEIVQRLRRFASVDIATSPVD
LPQLVDESIELINGTFRELGVLFEKRFDDSIPAIATHRAQVQQVLLQLLEAACQSLRHVP
LDDRIVKVTITRTSDLLCLSVIDSGTGHGESQLDELLGPYFATERSPISMGNALCYALVE
SLGGKMGRSSEPFTSGKSSGEGKAGSGAASDARVTSTAWFSLPIVEPPPGAKADQVAQQS
PARLLVTSIGR
Download sequence
Identical sequences D2QZB9
gi|283781416|ref|YP_003372171.1| WP_012912572.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]