SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781602|ref|YP_003372357.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|283781602|ref|YP_003372357.1|
Domain Number - Region: 222-302
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00314
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 463-516
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0641
Family LacY-like proton/sugar symporter 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283781602|ref|YP_003372357.1|
Sequence length 538
Comment lipopolysaccharide biosynthesis protein [Pirellula staleyi DSM 6068]
Sequence
MIEPQQIKTHVMTIVRALRKRWHVAALFAIVVMGLTFVGSLMMPRSYFSEAKVFVRFGRE
NLTLDPTASNGQLISIYESRESEINSLLEILRSRLVLDKVVEMLGPQYILHGHEKQIDPE
TGLTAENSTSDALVSSEIAKLEAVVDGIRPPAKPVIVVPSSDHQRAVLALEKELEIFAPK
KSNIISVACKAQTPDRAQRIVATMIAVYMEEHVRVHRTAGSYEFFERQTDQSLEQWRRAS
KELENAKNLLKISSIEGKRKQLEDQMAEIENRLKQGTAELAASESKIRGIEQQISKLPER
IETQSLEGPNAAYDGMRTQLFTLEAREFELAARSTDSHPQLIAVRQQISELRELLKEQGS
SRSQPTMSINPARQALELALHTEQSQVNWLRGRAQSLSKQKIALVQDLAALNNAEVRFAQ
LQRQVDLSEQRHRTYAEKLEQARINRSLDEERISSLSIVQPATFVAKPLGPRKLMVLALG
AFVAIVGGFGLAVILDYFFPTLVALRDLQQLGVPMLGVMPSFGASMQQAGNAPQFGQS
Download sequence
Identical sequences D2R112
gi|283781602|ref|YP_003372357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]